A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Glochidiol is an orally active tubulin polymerization inhibitor with an IC50 of 2.76 μM. Glochidiol shows anti-cancer activity. Uses: Designed for use in research and industrial production. Product Category: Inhibitors. Appearance: Powder. CAS No. 6610-56-6. Molecular formula: C30H50O2. Mole weight: 442.7. Purity: 0.98. IUPACName: (1R,3aR,5aR,5bR,7aS,9R,11R,11aR,11bS,13aR,13bR)-3a,5a,5b,8,8,11a-hexamethyl-1-prop-1-en-2-yl-1,2,3,4,5,6,7,7a,9,10,11,11b,12,13,13a,13b-hexadecahydrocyclopenta[a]chrysene-9,11-diol. Canonical SMILES: CC(=C)C1CCC2(C1C3CCC4C(C3(CC2)C)(CCC5C4(C(CC(C5(C)C)O)O)C)C)C. Product ID: ACM6610566. Alfa Chemistry ISO 9001:2015 Certified. Categories: Glochidion marianum.
Glofitamab
Glofitamab is a T-cell-engaging bispecific antibody possessing a novel 2:1 structure with bivalency for CD20 on B cells and monovalency for CD3 on T cells. Glofitamab is used as an effective therapy for relapsed or refractory diffuse large B-cell lymphoma. Synonyms: RO7082859; RG6026. CAS No. 2229047-91-8.
Glofitamab
Glofitamab (RO7082859) is a T-cell-engaging bispecific antibody possessing a novel 2:1 structure with bivalency for CD20 on B cells and monovalency for CD3 on T cells. Glofitamab leads to T-cell activation, proliferation, and tumor cell killing upon binding to CD20 on malignant cells. Glofitamab induces durable complete remissions in relapsed or refractory B-Cell non-Hodgkin lymphoma (B-NHL) [1] [2] [3] [4]. Uses: Scientific research. Group: Inhibitory antibodies. Alternative Names: RO7082859. CAS No. 2229047-91-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99024.
Glomecidin
It is produced by the strain of Streptomyces lavendulae H698 SY2. It has antibacterial activity on several plant pathogenic fungi, including Glomerella cingulata, Colletotrichum gloeosporioides and C. lagenarium with MIC (μg/mL) of 0.78, 0.78 and 1.56, respectively. It has no effect on other fungi, yeast and bacteria. Molecular formula: C27H37N7O7. Mole weight: 571.62.
Glomelliferonic acid is a depside from the Lichen Neofuscelia subincerta. Synonyms: ACMC-20miur; 11H-Dibenzo[b,e][1,4]dioxepin-7-carboxylic acid, 8-hydroxy-3-methoxy-11-oxo-1-(2-oxopentyl)-6-pentyl-; 8-Hydroxy-3-methoxy-11-oxo-1-(2-oxopentyl)-6-pentyl-11H-dibenzo[b,e][1,4]dioxepine-7-carboxylic acid. CAS No. 113706-23-3. Molecular formula: C25H28O8. Mole weight: 456.48.
Glomeratose A
Botanical Source: Group: Biochemicals. Grades: Plant Grade. CAS No. 202471-84-9. Pack Sizes: 10mg, 20mg. US Biological Life Sciences.
Worldwide
Glomerular Microvascular Endothelial Cells, Human (Frozen)
Passage 2 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: 1ml. US Biological Life Sciences.
Worldwide
Glomerular Microvascular Endothelial Cells, Human (T-25 flask)
Passage 2 cells are shipped in proliferating culture with a confluence of >90%. ENDO-Growth medium containing 5% serum and growth supplement is recommended for culture. Cells have an average population doubling level of >16 when cultured. Group: Biologicals. Grades: Cell Culture Grade. Pack Sizes: T-25 flask. US Biological Life Sciences.
Worldwide
Glomosporin
It is produced by the strain of Glomospora sp. BAUA 2825. It is a cyclic ester peptide antifungal antibiotic, and it has moderate anti-aspergillus flavus (including aspergillus Niger and Aspergillus Niger), yeast activity (MIC is 16 μg/mL). Synonyms: [(3R,18R)-9,12-bis(2-amino-2-oxoethyl)-3-[(1R)-1-hydroxyethyl]-6,21-bis(hydroxymethyl)-25-(2-hydroxytetradecan-2-yl)-18-methyl-2,5,8,11,14,17,20,23-octaoxo-1-oxa-4,7,10,13,16,19,22-heptaazacyclopentacosan-15-yl]acetic acid. CAS No. 288631-37-8. Molecular formula: C42H71N9O17. Mole weight: 974.06.
GloPIPs Biotin-PI(3,4,5)P3
GloPIPs Biotin-PI(3,4,5)P3 is labelled at the sn-1 position with BODIPY®-FL (505/513), BODIPY®-TMR (544/574), or biotin. The sn-1 linkage in these labelled PIPs has been changed to a more stable amide from an ester. Phosphatidylinositol 3,4,5-trisphosphate, formed from PI(4,5)P2 through phosphorylation by PI 3-kinase, activates numerous signaling pathways resulting in cell proliferation, growth, survival, glucose transport and protein synthesis. High PIP3 levels from disregulation of PI3-K have been demonstrated in cancer and inflammatory diseases. Grade: >95%. Molecular formula: C31H51N4Na7O23P4S. Mole weight: 1164.64.
GloPIPs Biotin-PI(3,4)P2
GloPIPs Biotin-PI(3,4)P2 is labelled at the sn-1 position with BODIPY®-FL (505/513), BODIPY®-TMR (544/574), or biotin. The sn-1 linkage in these labelled PIPs has been changed to a more stable amide from an ester. PI(3,4)P2 is produced in stimulated cells by the action of phosphatidylinositol 3-kinases (PI3Ks) and/or lipid phosphatases (SHIP, TPTE, etc.). PI(3,4)P2 binds the pleckstrin homology (PH)-domain of AKT/PKB leading to cell survival and it also has an important role in podosome formation near focal adhesions. Grade: >95%. Molecular formula: C31H52N4Na5O20P3S. Mole weight: 1040.69.
GloPIPs Biotin-PI(3,5)P2
GloPIPs Biotin-PI(3,5)P2 is labelled at the sn-1 position with BODIPY®-FL (505/513), BODIPY®-TMR (544/574), or biotin. The sn-1 linkage in these labelled PIPs has been changed to a more stable amide from an ester. PI(3,5)P2 is in very low abundance and is required for retrograde membrane trafficking from lysosomal and late endosomal compartments to the Golgi and is involved in autophagy. PI(3,5)P2 levels are controlled by the 5-kinase PIKfyve and the 5-phosphatase Fig4/Sac3 and disregulation is linked to several human neuropathies (eg Chacot-Marie-Tooth disease). Grade: >95%. Molecular formula: C31H52N4Na5O20P3S. Mole weight: 1040.69.
GloPIPs Biotin-PI(3)P
GloPIPs Biotin-PI(3)P is labelled at the sn-1 position with BODIPY®-FL (505/513), BODIPY®-TMR (544/574), or biotin. The sn-1 linkage in these labelled PIPs has been changed to a more stable amide from an ester. PI(3)P is enriched in early endosomes having roles in endosome fusion and receptor sorting and internalization in multivesicular bodies. PI(3)P has also been found at the plasma membrane and is involved in the translocation of the glucose transport protein GLUT4. Grade: >95%. Molecular formula: C31H53N4Na3O17P2S. Mole weight: 916.75.
GloPIPs Biotin-PI(4,5)P2
GloPIPs Biotin-PI(4,5)P2 is labelled at the sn-1 position with BODIPY®-FL (505/513), BODIPY®-TMR (544/574), or biotin. The sn-1 linkage in these labelled PIPs has been changed to a more stable amide from an ester. PI(4,5)P2 has been shown to play a central role in a variety of cellular functions. Amongst its many functions, PIP2 is a substrate for Phospholipase C-coupled G-protein pathways involved in intracellular calcium release in a number of tissues. It is also a substrate for class I phosphoinositide 3-kinase (PI3-K) forming PI(3,4,5)P3. Molecular formula: C35H53BF2N4O19P3. Mole weight: 975.55.
GloPIPs Biotin-PI(4)P
PI(4)P is the biosynthetic precursor to PI(4,5)P2 and has an important role in regulating sphingomyelin and glycosphingolipid metabolism and membrane trafficking at the exit of the Golgi complex. Molecular formula: C31H53N4Na3O17P2S. Mole weight: 916.75.
GloPIPs Biotin-PI(5)P
PI(5)P is a rare lipid found in the nucleus that can bind the PHD finger of the nuclear adapter protein ING2. PI(5)P is phosphorylated to PI(4,5)P2 by Type II PIP kinases. Molecular formula: C31H53N4Na3O17P2S. Mole weight: 916.75.
GlowDot
GlowDot. Uses: Cell imaging, ph sensing, fluorescence, drug delivery and etc. Group: other quantum dots.
Gloxazone
Gloxazone is an effective anaplasmacide. Uses: Designed for use in research and industrial production. Additional or Alternative Names: Contrapar, Gloxazon, GLOXAZONE, KTS, pharmaceutical, Kethoxal bis(thiosemicarbazone), NSC82116, AIDS125723, AIDS-125723, BW 356C61, CID9571200, KC 1331, WR 9838, (1-Ethoxyethyl)glyoxal bis(thiosemicarbazone). alpha.-Ethoxyethylglyoxal dithiosemicarbazone, 3-Ethoxy-2-oxobutyraldehyde bis(thiosemicarbazone), Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone), 2-((Aminocarbothioyl)hydrazono)-3-ethoxybutanal thiosemicarbazone, Butyraldehyde, 3-ethoxy-2-oxo-, bis(thiosemicarbazone, hemihydrate, 2507-91-7, Hydrazinecarbothioamide, 2, {2-[1-(1-ethoxyethyl)-1,2-ethanediylidene]bis-}. Product Category: Inhibitors. Appearance: Solid. CAS No. 2507-91-7. Molecular formula: C8H16N6OS2. Mole weight: 276.38. Purity: 0.96. IUPACName: [(E)-[(1E)-1-(carbamothioylhydrazinylidene)-3-ethoxybutan-2-ylidene]amino]thiourea. Canonical SMILES: CC(C(/C=N/NC(N)=S)=N\NC(N)=S)OCC. Density: 1.41g/cm³. Product ID: ACM2507917. Alfa Chemistry ISO 9001:2015 Certified.
GLP-1
Glucagon-like peptide-1 (GLP-1) is a potent insulin secretagogue that has multiple synergetic effects on the glucose-dependent insulin secretion pathways of the beta-cell. Synonyms: Glucagon-like peptide 1. CAS No. 89750-14-1. Molecular formula: C149H226N40O45. Mole weight: 3297.7.
GLP-1 (1-36) amide is a promising peptide hormone unlocking avenues for type 2 diabetes mellitus research. Its extraordinary resemblance to the native GLP-1 facilitates heightened glucose-dependent insulin secretion. Synonyms: Preproglucagon (92-127) amide (human, bovine, guinea pig, mouse, rat); Glucagon-like peptide 1 (1-36) amide (human, bovine, guinea pig, mouse, rat); H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2; L-histidyl-L-alpha-aspartyl-L-alpha-glutamyl-L-phenylalanyl-L-alpha-glutamyl-L-arginyl-L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-argininamide. Grade: ≥95%. CAS No. 99658-04-5. Molecular formula: C184H273N51O57. Mole weight: 4111.44.
GLP-1 (25-37), human
GLP-1 is a potent insulin secretagogue that has multiple synergetic effects on the glucose-dependent insulin secretion pathways of the beta-cell. Synonyms: Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly. Molecular formula: C70H111N19O16. Mole weight: 1474.84.
GLP-1(28-36)amide acetate
GLP-1(28-36)amide acetate inhibits mitochondrial permeability transition with antioxidant, anti-diabetic and cardioprotection activities. Molecular formula: C56H89N15O11. Mole weight: 1148.40.
GLP-1(32-36)amide
GLP-1(32-36)amide, a pentapeptide, derived from the C terminus of the glucoregulatory hormone GLP-1. GLP-1(32-36)amide could inhibit weight gain and modulate whole body glucose metabolism in diabetic mice [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1417302-71-6. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3102.
GLP-1 (7-36) Acetate
GLP-1 (7-36) is an intestinal hormone that stimulates glucose-induced β cells to secrete insulin. Synonyms: Human GLP-1-(7-36)-amide Acetate. Grade: >98%. CAS No. 1119517-19-9. Molecular formula: C149H226N40O45.xC2H4O2. Mole weight: 3394.67.
GLP-1(7-36) amide
GLP-1(7-36) amide is a glucose-dependent insulinotropic peptide displaying high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells (Kd = 204 pM). GLP-1 (7-36) amide exhibits antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration. Synonyms: GLP-1; GLP-1 (7-36) amide; Insulinotropin. Grade: 98%. CAS No. 107444-51-9. Molecular formula: C149H226N40O45. Mole weight: 3297.67.
GLP-1(7-36), amide
GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon-like peptide-1 (GLP-1)(7-36), amide; Human GLP-1 (7-36), amide. CAS No. 107444-51-9. Pack Sizes: 1 mg. Product ID: HY-P0054A.
GLP-1(7-36), amide acetate
GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells. Uses: Scientific research. Group: Peptides. Alternative Names: Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate. CAS No. 1119517-19-9. Pack Sizes: 500 μg; 1 mg; 5 mg; 10 mg. Product ID: HY-P0054.
GLP-1 (7-36) amide (chicken, common turkey)
GLP-1 (7-36) amide (chicken, common turkey). Synonyms: Preproglucagon (118-147) amide (chicken, common turkey); H-His-Ala-Glu-Gly-Thr-Tyr-Thr-Ser-Asp-Ile-Thr-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Asn-Gly-Arg-NH2; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-tyrosyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-isoleucyl-L-threonyl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-asparagyl-glycyl-L-argininamide; Glucagon-Like Peptide 1 (7-36) amide (chicken, common turkey). Grade: ≥95% by HPLC. CAS No. 1802078-26-7. Molecular formula: C149H224N40O47. Mole weight: 3327.66.
GLP-1 (7-36) amide trifluoroacetate salt
GLP-1 (7-36) amide is an important peptide hormone that displays a strong insulinotropic effect. It binds the GLP-1 receptor (pIC50 = 8.5) in the pancreas and shows various antidiabetic effects. Synonyms: Glucagon-like Peptide 1 (7-36) amide. Mole weight: 3297.6.
GLP-1 (7-37) is an insulinotropic peptide generated from the precursor peptide GLP-1 (1-37). It is a potent stimulator of insulin secretion at concentrations as low as 5 X 10(-11) M and has no effect on insulin secretion even at concentrations as high as 5 X 10(-7) M. It participates in the physiological regulation of insulin secretion. Uses: Glp-1 (7-37) acetate participates in the physiological regulation of insulin secretion. Synonyms: Proglucagon (78-108) (human, bovine, guinea pig, mouse, rat); Insulinotropin (human, bovine, guinea pig, mouse, rat); Glucagon-Like Peptide 1 (7-37) (human, bovine, guinea pig, mouse, rat); Preproglucagon (98-128) (human, bovine, guinea pig, mouse, rat); GLP-1 (7-37) human; Glucagon-like Peptide-1 (7-37); H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH; L-histidyl-L-alanyl-L-alpha-glutamyl-glycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-alpha-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-alpha-glutamyl-glycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-alpha-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysyl-glycyl-L-arginyl-glycine. Grade: 98%. CAS No. 106612-94-6. Molecular formula: C151H228N40O47. Mole weight: 3355.67.
GLP-1(7-37)
GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion. Uses: Scientific research. Group: Peptides. CAS No. 106612-94-6. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg. Product ID: HY-P0055.
Glp-1(7-37)acetate
Glp-1(7-37)acetate. Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLP-1 (7-37) acetate;GLP-1 (7-36) amide Acetate (GMP);GLP-1 (7-37) human;GLP-1 (7-37) (human, bovine, guinea pig, mouse, rat);Glucagon-like peptide 1 (7-37) (human). Product Category: Heterocyclic Organic Compound. CAS No. 106612-94-6. Molecular formula: C151H228N40O47. Mole weight: 3355.67. Purity: >95%. Product ID: ACM106612946. Alfa Chemistry ISO 9001:2015 Certified. Categories: GLP-1(7-37) Acetate.
GLP-1(7-37) acetate
GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion [1]. Uses: Scientific research. Group: Peptides. CAS No. 1450806-98-0. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-P0055A.
GLP-1 (9-36) amide
GLP-1 (9-36) amide is an N-terminal truncated metabolite of glucagon-like peptide GLP-1-(7-36) formed by dipeptidyl peptidase-IV cleavage. GLP-1 (9-36) amide functions as a human GLP-1 receptor antagonist. Synonyms: Glucagon-like peptide-1 (9-36) amide; Glucagon-like peptide-1 (9 36) amide. CAS No. 161748-29-4. Molecular formula: C140H214N36O43. Mole weight: 3089.44.
GLP-1(9-36)amide
GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 161748-29-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P1141.
GLP-1, IGF-1 (1-3) is a fragment of amino acids of Glucagon-like peptide-1. Grade: 98%. Molecular formula: C12H19N3O6. Mole weight: 301.3.
GLP-1 moiety from Dulaglutide
GLP-1 moiety from Dulaglutide is a fragment of Dulaglutide containing 31 amino acids, and Dulaglutide is a glucagonlike peptide 1 receptor (GLP-1) agonist. Synonyms: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly. Grade: ≥98%. Molecular formula: C149H221N37O49. Mole weight: 3314.62.
GLP-1R agonist 2
GLP-1R agonist 2 (compound 2) is an effective GLP-1R agonist that exerts its activating effect by forming hydrogen bonds with the Tyr42, Cys71, and Ser84 residues of GLP-1R. GLP-1R agonist 2 has the potential for research in metabolic diseases such as type 2 diabetes and obesity[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 281209-71-0. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-121835.
GLP-1R agonist 4
GLP-1R agonist 4 is a potent agonist of GLP-1R. Glucagon-like peptide-1 (GLP-1) is an intestinal hypoglycemic hormone secreted by L-cells in the lower gastrointestinal tract. GLP-1R agonist 4 has the potential for the research of diabetes (extracted from patent WO2019239319A1, compound 96) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2401894-26-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-144035.
GLP-1R agonist DMB
GLP-1R agonist DMB is a glucagon-like peptide-1 (GLP-1) receptor agonist used potentially for the treatment of type 2 diabetes. Uses: Potential treatment of type 2 diabetes. Synonyms: N-(tert-Butyl)-6,7-dichloro-3-(methylsulfonyl)quinoxalin-2-amine. Grade: 99%. CAS No. 281209-71-0. Molecular formula: C13H15Cl2N3O2S. Mole weight: 348.25.
GLP-1R Antagonist 1
GLP-1R Antagonist 1 (compound 5d) is an orally active, CNS penetrant and non-competitive antagonist of glucagon-like peptide 1 receptor (GLP-1R), with an IC50 of 650 nM[1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 488097-06-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-101116.
GLP-1 receptor agonist 10
GLP-1 receptor agonist 10 (compound 42) is an agonist of GLP Receptor. GLP-1 receptor agonist 10 inhibits food intake and reduces glucose excursion in mice. GLP-1 receptor agonist 10 can be used in the study of type 2 diabetes (T2DM) and obesity [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 3015555-46-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-153798.
GLP-1 receptor agonist 12
GLP-1 receptor agonist 12 (compound 20A) is an agonist of GLP Receptor. GLP-1 receptor agonist 12 can be used in the study of diseases such as diabetes [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2775376-50-4. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-153816.
GLP-1 receptor agonist 2
GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist. Uses: Scientific research. Group: Signaling pathways. CAS No. 2230197-64-3. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg. Product ID: HY-112679.
GLP-1 receptor agonist 2
GLP-1 receptor agonist 2 is an agonist of glucagon-like peptide-1 receptor (GLP-1R). Synonyms: 1H-Benzimidazole-6-carboxylic acid, 2-[[(2S)-4-[6-[(4-chloro-2-fluorophenyl)methoxy]-2-pyridinyl]-2-methyl-1-piperazinyl]methyl]-1-[(2S)-2-oxetanylmethyl]-; 2-{[(2S)-4-{6-[(4-Chloro-2-fluorobenzyl)oxy]-2-pyridinyl}-2-methyl-1-piperazinyl]methyl}-1-[(2S)-2-oxetanylmethyl]-1H-benzimidazole-6-carboxylic acid. Grade: ≥95%. CAS No. 2230197-64-3. Molecular formula: C30H31ClFN5O4. Mole weight: 580.05.
GLP-1 receptor agonist 3
GLP-1 receptor agonist 3 is a GLP-1 receptor agonist with EC50s of 1.1 and 13 nM in Clone H6 and Clone C6 cell lines assay, respectively. (Extracted from patent WO2018109607A1, Example 4A-1). Synonyms: 1H-Benzimidazole-6-carboxylic acid, 2-[[4-[6-[(4-cyano-2-fluorophenyl)methoxy]-2-pyridinyl]-1-piperidinyl]methyl]-1-[(2R)-2-oxetanylmethyl]-; 2-[(4-{6-[(4-Cyano-2-fluorobenzyl)oxy]-2-pyridinyl}-1-piperidinyl)methyl]-1-[(2R)-2-oxetanylmethyl]-1H-benzimidazole-6-carboxylic acid. Grade: ≥95%. CAS No. 2230200-09-4. Molecular formula: C31H30FN5O4. Mole weight: 555.60.
GLP-1 receptor agonist 4
GLP-1 receptor agonist 4, a glucagon-like peptide-1 receptor (GLP-1R) agonist with an EC50 of 64.5 nM, can be used in the study of diabetes treatment. (Extracted from patent WO2009111700A2, compound 87). Synonyms: (S)-3-(4'-Cyano-[1,1'-biphenyl]-4-yl)-2-((3R,8S)-3-(4-((3,4-dichlorobenzyl)oxy)phenyl)-1-methyl-2-oxo-7-((S)-1-phenylpropyl)-2,3,6,7,8,9-hexahydro-1H-[1,4]oxazino[3,2-g]isoquinoline-8-carboxamido)propanoic acid; (2S)-3-(4'-Cyano-4-biphenylyl)-2-[({(3R,8S)-3-{4-[(3,4-dichlorobenzyl)oxy]phenyl}-1-methyl-2-oxo-7-[(1S)-1-phenylpropyl]-2,3,6,7,8,9-hexahydro-1H-[1,4]oxazino[3,2-g]isoquinolin-8-yl}carbonyl)amino]propanoic acid. Grade: ≥95%. CAS No. 1187061-62-6. Molecular formula: C51H44Cl2N4O6. Mole weight: 879.82.
GLP-1 receptor agonist 7
GLP-1 receptor agonist 7 is a potent glucagon-like peptide-1 (GLP-1) agonist with potential to study GLP-1-related diseases, disorders and conditions, including diabetes mellitus. (Extracted from patent WO2021219019A1, compound 130b). Synonyms: 2-((4-((S)-3-(4-chloro-2-fluorophenyl)-2,3-dihydrobenzo[b][1,4]dioxin-5-yl)piperidin-1-yl)methyl)-3-(((S)-oxetan-2-yl)methyl)-3H-imidazo[4,5-b]pyridine-5-carboxylic acid. CAS No. 2736447-04-2. Molecular formula: C31H30ClFN4O5. Mole weight: 593.05.
GLP-1 receptor agonist 7
GLP-1 receptor agonist 7 is a potent agonist of glucagon-like peptide-1 ( GLP-1 ). GLP-1 receptor agonist 7 has the potential for the research of GLP-1-associated diseases, disorders, and conditions including diabetes mellitus (extracted from patent WO2021219019A1, compound 130b) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 2736447-04-2. Pack Sizes: 5 mg; 10 mg. Product ID: HY-145412.
GLP-1 receptor agonist 8
GLP-1 receptor agonist 8, a potent GLP-1 receptor agonist, has potential in the study of diabetes, obesity and non-alcoholic fatty liver disease (NAFLD). (Extracted from patent WO2019239319A1, compound 17). Synonyms: ammonium (R)-2-((4-(2-(4-chloro-2-fluorophenyl)-2-methylbenzo[d][1,3]dioxol-4-yl)piperidin-1-yl)methyl)-1-((1-ethyl-1H-imidazol-5-yl)methyl)-1H-benzo[d]imidazole-6-carboxylate. CAS No. 2401892-86-0. Molecular formula: C34H36ClFN6O4. Mole weight: 647.14.
GLP-1 receptor agonist 9
GLP-1 receptor agonist 9 is an agonist of GLP-1 receptor. (Extracted from WO2020234726 A1, example 7). Synonyms: 1H-Benzimidazole-6-carboxylic acid, 2-[[4-[(2S)-2-(4-chloro-2-fluorophenyl)-2-methyl-1,3-benzodioxol-4-yl]-1-piperidinyl]methyl]-1-[(2S)-2-oxetanylmethyl]-. Grade: ≥95%. CAS No. 2401892-71-3. Molecular formula: C32H31ClFN3O5. Mole weight: 592.06.
GLP-1 receptor agonist 9 citrate
GLP-1 receptor agonist 9 is an agonist of GLP-1 receptor. Molecular formula: C38H39ClFN3O12. Mole weight: 784.18.
GLP-1R modulator C16
GLP-1R modulator C16 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through transmembrane site with an EC50 of 8.43±3.82 μM. Synonyms: N-{4-[(2-chloro-6-fluorobenzyl)oxy]-3-methoxybenzyl}-N-[2-(4-morpholinyl)ethyl]amine; N-{4-[(2-Chloro-6-fluorobenzyl)oxy]-3-methoxybenzyl}-2-(4-morpholinyl)ethanamine; 4-Morpholineethanamine, N-[[4-[(2-chloro-6-fluorophenyl)methoxy]-3-methoxyphenyl]methyl]-. Grade: ≥90%. CAS No. 875005-43-9. Molecular formula: C21H26ClFN2O3. Mole weight: 408.89.
GLP-1R modulator C5
GLP-1R modulator C5 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through transmembrane site with an EC50 of 1.59±0.53 μM. Synonyms: 3-hydroxy-3-(2-oxo-2-phenylethyl)-1-(2-phenylethyl)-1,3-dihydro-2H-indol-2-one; 2H-Indol-2-one, 1,3-dihydro-3-hydroxy-3-(2-oxo-2-phenylethyl)-1-(2-phenylethyl)-. Grade: ≥90%. CAS No. 421578-93-0. Molecular formula: C24H21NO3. Mole weight: 371.43.
GLP-1R modulator C5
GLP-1R modulator C5 is an allosteric modulator enhancing GLP-1 binding to GLP-1R via a transmembrane site (EC50 1.59 ± 0.53 ?M). Uses: Scientific research. Group: Signaling pathways. CAS No. 421578-93-0. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-141840.
GLP-1R modulator L7-028
GLP-1R modulator L7-028 is an allosteric modulator that enhances the binding of GLP-1 to GLP-1R through transmembrane site with an EC50 of 11.01±2.73 μM. Synonyms: Benzamide, 3-(cyclopentyloxy)-N-[3-(1-piperidinylcarbonyl)phenyl]-. Grade: ≥95%. CAS No. 2648317-95-5. Molecular formula: C24H28N2O3. Mole weight: 392.49.
GLP-1 TFA
GLP-1 is a potent insulin secretagogue that has multiple synergetic effects on the glucose-dependent insulin secretion pathways of the beta-cell. Synonyms: GLP-1 trifluoroacetate salt; Glucagon-like peptide 1 trifluoroacetate salt; H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2.TFA.
GLP-2 (1-33) (human)
GLP-2 (human) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Glucagon-like peptide 2 (human); GLP-2 (human); GLP 2 (human). Grade: >98%. CAS No. 223460-79-5. Molecular formula: C165H254N44O55S. Mole weight: 3766.1.
GLP-2(1-33)(human)
GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium. Uses: Scientific research. Group: Peptides. Alternative Names: GLP-2 (human); Glucagon-like peptide 2 (human). CAS No. 223460-79-5. Pack Sizes: 500 ?g; 1 mg; 5 mg. Product ID: HY-P1024.
GLP-2 (1-34) (human)
GLP-2 (1-34) (human) is a human-derived mimic of glucagon-like peptide 2 employed in studying gastrointestinal disorders such as short bowel syndrome (SBS). Synonyms: Preproglucagon (146-179) (human); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH; L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-alanyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-alpha-aspartyl-L-arginine. Grade: 95%. CAS No. 99120-49-7. Molecular formula: C171H266N48O56S1. Mole weight: 3922.29.
GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor ( EC 50 =5.8 nM) [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 275801-62-2. Pack Sizes: 1 mg; 5 mg. Product ID: HY-P2625.
GLP-26
GLP-26 is an HBV capsid assembly modulator (CAM) that inhibits HBV DNA replication (IC50 = 3 nM) in Hep AD38 system and reduces cccDNA by >90% at 1 μM. GLP-26 disrupts pregenomic RNA encapsulation, leading to nucleocapsid disintegration and reduced cccDNA pools. Synonyms: N-(3,4-Difluorophenyl)-1,3,5-trimethyl-4-(2-oxo-2-(prop-2-yn-1-ylamino)acetyl)-1H-pyrrole-2-carboxamide; N-(3,4-Difluorophenyl)-1,3,5-trimethyl-4-[oxo(2-propyn-1-ylamino)acetyl]-1H-pyrrole-2-carboxamide; 1H-Pyrrole-3-acetamide, 5-[[(3,4-difluorophenyl)amino]carbonyl]-1,2,4-trimethyl-α-oxo-N-2-propyn-1-yl-. Grade: ≥98%. CAS No. 2133017-36-2. Molecular formula: C19H17F2N3O3. Mole weight: 373.35.
Glp-2(rat)
GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR). Uses: Designed for use in research and industrial production. Additional or Alternative Names: GLUCAGON-LIKE PEPTIDE 2 (RAT);GLUCAGON-LIKE PEPTIDE II RAT;GLP-2 (RAT);H-HIS-ALA-ASP-GLY-SER-PHE-SER-ASP-GLU-MET-ASN-THR-ILE-LEU-ASP-ASN-LEU-ALA-THR-ARG-ASP-PHE-ILE-ASN-TRP-LEU-ILE-GLN-THR-LYS-ILE-THR-ASP-OH;HADGSFSDEMNTILDNLATRDFINWLIQTKITD;PREPROGLUCAG. Product Category: Inhibitors. Appearance: Solid. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.14. Purity: 0.9804. Product ID: ACM195262567. Alfa Chemistry ISO 9001:2015 Certified.
GLP-2 (rat)
GLP-2 (rat) is an endogenous peptide that acts as an intestinal epithelium-specific growth factor. It stimulates cell proliferation and inhibits apoptosis, and also modulates intestinal glucose transport, food intake, and gastric acid secretion. Synonyms: Preproglucagon (146-178) (rat); H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Thr-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-OH; Glucagon-like Peptide 2 (rat); L-histidyl-L-alanyl-L-alpha-aspartyl-glycyl-L-seryl-L-phenylalanyl-L-seryl-L-alpha-aspartyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-threonyl-L-isoleucyl-L-leucyl-L-alpha-aspartyl-L-asparagyl-L-leucyl-L-alanyl-L-threonyl-L-arginyl-L-alpha-aspartyl-L-phenylalanyl-L-isoleucyl-L-asparagyl-L-tryptophyl-L-leucyl-L-isoleucyl-L-glutaminyl-L-threonyl-L-lysyl-L-isoleucyl-L-threonyl-L-aspartic acid. Grade: ≥95%. CAS No. 195262-56-7. Molecular formula: C166H256N44O56S. Mole weight: 3796.17.