A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| K+-transporting ATPase | A P-type ATPase that undergoes covalent phosphorylation during the transport cycle. A bacterial enzyme of di(heterotetrameric) structure that is involved in K+ import. The probable stoichiometry is one ion per ATP hydrolysed. Group: Enzymes. Synonyms: K+-translocating Kdp-ATPase; multi-subunit K+-transport ATPase. Enzyme Commission Number: EC 7.2.2.6 (Formerly EC 3.6.3.12). Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4649; K+-transporting ATPase; EC 3.6.3.12; K+-translocating Kdp-ATPase; multi-subunit K+-transport ATPase. Cat No: EXWM-4649. |  |
| KTRNQMSFKETNGLEKIFQDHPLQKTYNYNVLMVPKQ | KTRNQMSFKETNGLEKIFQDHPLQKTYNYNVLMVPKQ. Synonyms: Lys-Thr-Arg-Asn-Gln-Met-Ser-Phe-Lys-Glu-Thr-Asn-Gly-Leu-Glu-Lys-Ile-Phe-Gln-Asp-His-Pro-Leu-Gln-Lys-Thr-Tyr-Asn-Tyr-Asn-Val-Leu-Met-Val-Pro-Lys-Gln. Molecular formula: C199H315N55O58S2. Mole weight: 4470.16. |  |
| KU-0058948 | KU-0058948 is a poly (ADP-ribose) polymerase (PARP) inhibitor. Studies show that KU-0058948 a potent agonist that activates transfected extracellular signal-regulated kinase 8 (ERK8) in cells. KU-0058948 induces cell cycle arrest and apoptosis of primary myeloid leukemic cells and myeloid leukemic cell lines in vitro. Group: Biochemicals. Alternative Names: 4- [ [4-fluoro-3- [ (hexahydro-1H-1, 4-diazepin-1-yl) carbonyl] phenyl] methyl] -1 (2H) -phthalazinone; KU 0058948; KU0058948; 1- [5- [ (3, 4-dihydro-4-oxo-1-phthalazinyl) methyl] -2-fluorobenzoyl] hexahydro-1H-1, 4-diazepine. Grades: Highly Purified. CAS No. 763111-49-5. Pack Sizes: 10mg. US Biological Life Sciences. |  Worldwide |
| KU 0060648 | Dual PI 3-K and DNA-PK inhibitor (IC50 values are <0.1, 0.5, 4 and 19 nM for PI 3-Kdelta, PI 3-Kbeta, PI 3-Kalpha and DNA-PK respectively). Inhibits proliferation of MCF7 cells in vitro and delays growth of MCF7 xenografts in mice. Also enhances CRISPR-Cas9-mediated homology- directed repair (HDR) efficiency, and attenuates nonhomologous end-joining (NHEJ). Group: Biochemicals. Alternative Names: 4-Ethyl-N-[4-[2-(4-morpholinyl)-4-o xo-4H-1-benzopyran-8-yl]-1-dibenzothienyl]-1-piper azineacetamide. Grades: Highly Purified. CAS No. 881375-00-4. Pack Sizes: 10mg. Molecular Formula: C??H??N?O?S, Molecular Weight: 582.71. US Biological Life Sciences. | Worldwide |
| KU-0060648 | KU-0060648 is a dual inhibitor of PI3K and DNA-PK with IC50s of 4 nM, 0.5 nM, 0.1 nM, 0.594 nM and 8.6 nM for PI3Kα, PI3Kβ, PI3Kγ, PI3Kδ and DNA-PK, respectively[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 881375-00-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-13431. |  |
| KU-0063794 | KU-0063794 is a potent and specific mTOR inhibitor, inhibiting both the mTORC1 and mTORC2 complexes with IC50s of 10 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 938440-64-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-50710. | |
| KU14R | KU14R. Group: Biochemicals. Grades: Purified. CAS No. 189224-48-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| KU-55933 | KU-55933 is a potent ATM inhibitor with an IC50 and Ki of 12.9 and 2.2 nM, respectively, and is highly selective for ATM as compared to DNA-PK, PI3K/PI4K, ATR and mTOR. Uses: Scientific research. Category: Signaling pathways. CAS No. 587871-26-9. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-12016. | |
| KU-55933 | KU-55933 is a potent and specific ATM inhibitor with IC50/Ki of 12.9 nM/2.2 nM in cell-free assays, and is highly selective for ATM as compared to DNA-PK, PI3K/PI4K, ATR and mTOR. KU - 55933 (ATM Kinase Inhibitor) inhibits the activation of autophagy - initiating kinase ULK1 and results in a significant decrease of autophagy. Group: Inhibitors. Alternative Names: ATM Kinase Inhibitor. CAS No. 587871-26-9. Pack Sizes: 5mg. Product ID: S1092. Formula: C21H17NO3S2. Smiles: C1COCCN1C2=CC(=O)C=C(O2)C3=C4C(=CC=C3)SC5=CC=CC=C5S4. Storage Conditions: 2 years -80 in solvent. |  United States; Europe |
| KU-57788 | KU-57788 (NU7441) is a highly potent and selective DNA-PK inhibitor with an IC50 of 14 nM. KU-57788 is an NHEJ pathway inhibitor. KU-57788 also inhibits PI3K and mTOR with IC50s of 5.0 and 1.7 μM, respectively[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: NU7441. CAS No. 503468-95-9. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg; 500 mg. Product ID: HY-11006. | |
| KU 59403 | KU 59403 is a potent ATM inhibitor, with IC50 values of 3 nM, 9.1 μM and 10 μM for ATM, DNA-PK and PI3K, respectively[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 845932-30-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg. Product ID: HY-18650. | |
| KU-60019 | KU-60019 is an improved ATM kinase-specific inhibitor with IC50 of 6.3 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 925701-46-8. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg. Product ID: HY-12061. | |
| KU-60019 | KU-60019 is an improved analogue of KU-55933, with IC50 of 6.3 nM for ATM in cell-free assays, 270- and 1600-fold more selective for ATM than DNA-PK and ATR,and is a highly effective radiosensitizer. Group: Inhibitors. CAS No. 925701-49-1. Pack Sizes: 10mg. Product ID: S1570. Formula: C30H33N3O5S. Smiles: CC1CN(CC(O1)C)CC(=O)NC2=CC3=C(C=C2)SC4=C(C3)C=CC=C4C5=CC(=O)C=C(O5)N6CCOCC6. Storage Conditions: 2 years -80 in solvent. | United States; Europe |
| Ku70 | KU70 is a cell-penetrating peptide used to block the activity of KU70 antibody. Synonyms: H-Val-Pro-Met-Leu-Lys-Pro-Met-Leu-Lys-Glu-OH; L-valyl-L-prolyl-L-methionyl-L-leucyl-L-lysyl-L-prolyl-L-methionyl-L-leucyl-L-lysyl-L-glutamic acid. Grade: >98%. Molecular formula: C54H96N12O13S2. Mole weight: 1185.55. | |
| Kuanoniamine c | Kuanoniamine c. Alternative Names: KUANONIAMIME C;kuanoniamine c from oceanappia sp. CAS No. 133401-11-3. Product ID: ACM133401113. Molecular formula: C21H18N4OS. Mole weight: 360.483. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| Kudzu Extract | Kudzu root extract is extracted from the plant in the genus pueraria in the pea family Fabaceae, subfamily faboideae. In traditional Chinese medicine, kudzu root extract puerarin is used in prescriptions for the treatment of thirst, headache, and stiff neck with pain due to high blood pressure. Kudzu root extract, also known as radix puerariae extract, contains a variety of phytochemicals, which are potent antioxidant compounds found naturally in plants, that help to prevent and treat human disease. Group: Others. Mole weight: 416.38. Kudzu Extract; Pueraria Edulis Pampan. Cat No: EXTC-013. | |
| Kudzu Root Extract (Standard) | Kudzu root has been known for centuries in traditional Chinese medicine as ge-gen. The first written mention of the plant as a medicine is in the ancient herbal text of Shen Nong (about A.D.100). In traditional Chinese medicine, kudzu root is used in prescriptions for the treatment of thirst, headache, and stiff neck with pain due to high blood pressure. It is also recommended for allergies, migraine headaches, inadequate measles eruptions in children, and diarrhea It is also used in modern Chinese medicine as a treatment for angina pectoris. Applications: Kudzu root extract is used as remedy for diaphoretic,antispasmodic,muscle relaxant,antipyretic.kudzu root extract is also used for fevers caused by heat in colds and influenza and for stiff neck and shoulders. Group: Others. CAS No. Puerarin: 3681-99-0Genistein: 446-72-0Daidzin: 552-66-9Daidzein: 486-66-8. Purity: 40.0% Isoflavones UV/HPLC. Mole weight: Puerarin: 416.37Genistein: 270.23Daidzin: 416.38Daidzein: 254.23. Kudzu Root Extract (Standard); Puerarin: 3681-99-0Genistein: 446-72-0Daidzin: 552-66-9Daidzein: 486-66-8; Puerarin: C21H20O9Genistein: C15H10O5Daidzin: C21H20O9Daidzein: C10H15O4. Cat No: EXTW-008. | |
| Kukoamine A | Kukoamine A, a spermine alkaloid, is an orally active and brain-penetrant component found in the root barks of Lycium chinense (L. chinense) Miller. Kukoamine A inhibits purified Crithidia fasciculata trypanothione reductase and soybean lipoxygenase, activates μ-opioid receptor. Kukoamine A can inhibt cancer cell proliferation, migration and invasion, cause G0/G1 phase cell cycle arrest and induce apoptosis. Kukoamine A exerts neuroprotective effect and can induce autophagy. Kukoamine A inhibits LPS (HY-D1056)-induced NO, ROS, PGE2, TNF-α, IL-1β, IL-6 production and COX-2 activity. Kukoamine A reverses palmitic acid-induced insulin resistance, lipid accumulation, and oxidative stress via downregulation of Srebp-1c. Kukoamine A can be used for the research of cancer, infection, inflammation, metabolic and neurological disease, such as glioblastoma and Parkinson's disease[1][2][3][4][5][6][7]. Uses: Scientific research. Category: Signaling pathways. CAS No. 75288-96-9. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg. Product ID: HY-N2392. | |
| Kukoamine A | Kukoamine A. Group: Biochemicals. Grades: Plant Grade. CAS No. 75288-96-9. Pack Sizes: 10mg. Molecular Formula: C28H42N4O6, Molecular Weight: 530.66. US Biological Life Sciences. | Worldwide |
| Kukoamine B | Kukoamine B. Group: Biochemicals. Grades: Plant Grade. CAS No. 164991-67-7. Pack Sizes: 10mg. Molecular Formula: C28H42N4O6, Molecular Weight: 530.66. US Biological Life Sciences. | Worldwide |
| KukoaMine B Impurity 4 | KukoaMine B Impurity 4. Uses: For analytical and research use. Molecular formula: C26H30N4O4. Mole weight: 462.55. Catalog: APB12259. |  |
| KukoaMine Impurity 1 | KukoaMine Impurity 1. Uses: For analytical and research use. Molecular formula: C26H28O4. Mole weight: 404.51. Catalog: APB12258. | |
| KukoaMine Impurity 2 | KukoaMine Impurity 2. Uses: For analytical and research use. Molecular formula: C66H74N4O9. Mole weight: 1067.34. Catalog: APB12257. | |
| KukoaMine Impurity 3 | KukoaMine Impurity 3. Uses: For analytical and research use. Molecular formula: C64H70N4O8. Mole weight: 1023.28. Catalog: APB12260. | |
| Kukui Nut Oil | Kukui nut oil, cold-pressed and refined; rich in oleic and linoleic acids, effective emollient. SAP 185-195. CAS No. 8015-80-3. Product ID: CI-SC-0483. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Kumbicin C | Kumbicin C is a bis-indolyl benzenoid fungal metabolite produced by A. kumbius FRR6049. Kumbicin C was found to inhibit the growth of mouse myeloma cells (IC50 = 0.74 μg/mL) and the Gram-positive bacterium Bacillus subtilis (MIC = 1.6 μg/mL). Synonyms: 5,8-di-1H-indol-3-yl-7-methoxy-2,2-dimethyl-2H-1-benzopyran-6-ol. Grade: ≥95%. CAS No. 1878151-58-6. Molecular formula: C28H24N2O3. Mole weight: 436.50. | |
| Kumquat Base | Kumquat Base. CAS No. MIXTURE. VIGON Item # 504913. Categories: Speciality Ingrdients Suppliers, Fragrances, Perfumers. |  America & Internationally |
| KUNB31 | KUNB31 is a selective inhibitor of SP90β with an Kd value of 0.18 μM[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2220263-80-7. Pack Sizes: 1 mg; 5 mg. Product ID: HY-122876. | |
| Kunitz-type serine protease inhibitor 1 | Kunitz-type serine protease inhibitor 1 is a Kunitz protease inhibitor isolated from Xanthosoma sagittifolium. It has activity against gram-negative bacteria. Synonyms: Pro-Val-Val-Asp-Thr-Thr-Gly-Asn-Asn-Pro-Leu-Gln-Gln-Gln-Glu-Glu-Tyr-Tyr-Val. Grade: 96.4%. Molecular formula: C96H144N24O35. Mole weight: 2194.34. | |
| kunzeaol synthase | Isolated from the root of the plant Thapsia garganica. The enzyme also produces germacrene D, bicyclogermacrene and traces of other sesquiterpenoids. See EC 4.2.3.77, (+)-germacrene D synthase and EC 4.2.3.100, bicyclogermacrene synthase. Group: Enzymes. Synonyms: TgTPS2 (gene name). Enzyme Commission Number: EC 4.2.3.143. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5157; kunzeaol synthase; EC 4.2.3.143; TgTPS2 (gene name). Cat No: EXWM-5157. | |
| Kurarinone | Kurarinone. Group: Biochemicals. CAS No. 34981-26-5. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| Kurarinone, 2'-O-methyl- | Kurarinone, 2'-O-methyl-. Group: Biochemicals. Grades: Plant Grade. CAS No. 270249-38-2. Pack Sizes: 5mg. Molecular Formula: C27H32O6, Molecular Weight: 452.55. US Biological Life Sciences. | Worldwide |
| Kurasoin A | It is produced by the strain of Paecilomyces sp. FO-3184, Kurasoin A has the effect of inhibiting the protein fannicyl transferase. Synonyms: (+)-Kurasoin A; (S)-3-Hydroxy-4-(4-hydroxyphenyl)-1-phenyl-2-butanone. CAS No. 182232-62-8. Molecular formula: C16H16O3. Mole weight: 256.30. | |
| Kurasoin B | It is produced by the strain of Paecilomyces sp. FO-3184, Kurasoin B has the effect of inhibiting the protein fannicyl transferase. Synonyms: (+)-Kurasoin B. Molecular formula: C18H17NO2. Mole weight: 279.33. | |
| Kuromanin chloride | Kuromanin chloride (Chrysontemin) is derived from mulberry leaves and has the effect of increasing blood sugar concentration and maintaining lipid metabolism balance to reduce obesity. Kuromanin chloride can inhibit CD38 enzymatic activities[1][2][3]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Chrysontemin; Cyanidin 3-O-glucoside chloride. CAS No. 7084-24-4. Pack Sizes: 10 mM * 1 mL in DMSO; 2 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-N0640. | |
| Kushenol A | Kushenol A isolated from the roots of Sophora flavescens Ait. It shows selective alpha-glucosidase inhibitory activity. Synonyms: Leachianone E. Grade: > 95%. CAS No. 99217-63-7. Molecular formula: C25H28O5. Mole weight: 408.5. | |
| Kushenol A | Kushenol A. Group: Biochemicals. Grades: Plant Grade. CAS No. 99217-63-7. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| Kushenol A | Kushenol A (Leachianone E) is isolated from the root of Sophora flavescent. Kushenol A is a non-competitive tyrosinase inhibitor to block the conversion of L-tyrosine to L-DOPA, shows IC50 and Kivalues of 1.1 μM and 0.4 μM, respectively[1]. Kushenol A is a flavonoid antioxidant, has inhibitory effects on alpha-glucosidase (IC50: 45 μM; Ki: 6.8 μM) and β-amylase[2]. Kushenol A is confirmed as potential inhibitors of enzymes targeted by cosmetics for skin whitening and aging[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Leachianone E. CAS No. 99217-63-7. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg. Product ID: HY-N2278. | |
| Kushenol F (Sophoraflavanone G) | Kushenol F (Sophoraflavanone G). Group: Biochemicals. Alternative Names: 2?,4?,5,7-Tetrahydroxy-6-lavandulylflavanone; Norkurarinone;34981-24-3. Grades: Plant Grade. CAS No. 97938-30-2. Pack Sizes: 10mg. Molecular Formula: C25H28O6, Molecular Weight: 424.485999999999. US Biological Life Sciences. | Worldwide |
| Kushenol I | Kushenol I. Group: Biochemicals. Grades: Plant Grade. CAS No. 99119-69-4. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| Kushenol X | Kushenol X isolated from the roots of Sophora flavescens Ait. Uses: Antibacterial; antiandrogen. Synonyms: (2R,3R)-2-(2,4-Dihydroxyphenyl)-3,5,7-trihydroxy-8-(2-isopropenyl-5-methyl-4-hexen-1-yl)-2,3-dihydro-4H-chromen-4-one. Grade: 0.98. CAS No. 254886-77-6. Molecular formula: C25H28O7. Mole weight: 440.5. | |
| Kuwanon A | Kuwanon A. Group: Biochemicals. CAS No. 62949-77-3. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| Kuwanon E | Kuwanon E is a flavonoid isolated from Morus alba, cytotoxic to human monocytic leukemic cell lines, and reduces the level of IL-1β[1]. Uses: Scientific research. Category: Natural products. CAS No. 68401-05-8. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N3514. | |
| Kuwanon E | Kuwanon E. Group: Biochemicals. CAS No. 68401-05-8. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| Kuwanon E | Kuwanon E is a flavonoid compound found in the root bark of Morus alba L. Synonyms: (S)-2-[5-[(E)-3,7-Dimethyl-2,6-octadienyl]-2,4-dihydroxyphenyl]-2,3-dihydro-5,7-dihydroxy-4H-1-benzopyran-4-one; 5'-[(E)-3,7-Dimethyl-2,6-octadienyl]-2',4',5,7-tetrahydroxyflavanone. Grade: >98%. CAS No. 68401-05-8. Molecular formula: C25H28O6. Mole weight: 424.5. | |
| Kuwanon G | Kuwanon G is a flavonoid compound and an antagonist of the bombesin receptor. Kuwanon G has multiple activities such as bactericidal, anti-tumor, anti-inflammatory, antioxidant, anti-atherosclerotic, and neuroprotective effects. Kuwanon G exhibits strong antibacterial activity against oral pathogens, especially cariogenic bacteria and periodontal pathogens. Kuwanon G can induce apoptosis and inhibit proliferation, migration, and invasion of tumor cells. Kuwanon G can be used in the research of diseases such as gastric cancer and atherosclerosis[1][2][3][4][5]. Uses: Scientific research. Category: Signaling pathways. CAS No. 75629-19-5. Pack Sizes: 5 mg; 10 mg. Product ID: HY-N4247. | |
| Kuwanon G | Kuwanon G. Group: Biochemicals. Grades: Highly Purified. CAS No. 75629-19-5. Pack Sizes: 1mg, 2mg, 5mg, 10mg, 25mg. Molecular Formula: C40H36O11. US Biological Life Sciences. | Worldwide |
| Kuwanon H | Kuwanon H is a flavonoid isolated from Morus alba, which acts as a potent non-peptide bombesin receptor antagonist. Kuwanon H selectively inhibits binding of gastrin releasing peptide CRP to GRP-preferring recepotr, with a Ki value of 290 nM in cells[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 76472-87-2. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-N2600. | |
| Kuwanon H | Kuwanon H. Group: Biochemicals. CAS No. 76472-87-2. Pack Sizes: 5mg. US Biological Life Sciences. | Worldwide |
| Kuwanon K | Kuwanon K is a natural product that can be isolated from Morus Lhou[1]. Uses: Scientific research. Category: Natural products. CAS No. 88524-66-7. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N11463. | |
| Kuwanon U | Kuwanon U is a potent cholinesterase inhibitor with IC50s of 19.69, 10.11 μM and Kis of 6.48, 9.59 μM for acetylcholinesterase (AChE) and butyrylcholinesterase (BChE), respectively. Kuwanon U has the potential for the research of Alzheimers disease (AD)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 123702-95-4. Pack Sizes: 1 mg; 5 mg. Product ID: HY-N12581. | |
| KV2 channel inhibitor-1 | KV2 channel inhibitor-1 is a selective KV2 channel inhibitor with IC50s of 0.2 μM and 0.41 μM for KV2.1 and KV2.2, respectively. KV2 channel inhibitor-1 possesses good selectivity over KV1.2 (IC50>10 μM). KV2 channel inhibitor-1 is >10-fold selective over NaV channels and other KV channels and displays weak activity on CaV channels[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 689297-68-5. Pack Sizes: 5 mg; 10 mg. Product ID: HY-44153. | |
| Kv3, Channel Containing Protein 567-585 | Kv3, Channel Containing Protein 567-585 is the 567-585 amino acid fragment of Kv3.1b channel containing protein. Kv3 channel protein is expressed by globus pallidus neurons Containing parvalbumin (PV). Synonyms: Cys-Lys-Glu-Ser-Pro-Val-Ile-Ala-Lys-Tyr-Met-Pro-Thr-Glu-Ala-Val-Arg-Val-Thr. Grade: ≥95%. Molecular formula: C93H156N24O28S2. Mole weight: 2122.50. | |
| KVD-001 | KVD-001 is a potent plasma kallikrein inhibitor. KVD-001 can be used for diabetic macular edema research[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1417691-95-2. Pack Sizes: 5 mg; 10 mg; 25 mg. Product ID: HY-W662576. | |
| KVS0001 | KVS0001 is a selective SMG1 inhibitor. KVS0001 elevates the expression of transcripts and proteins resulting from truncating mutations. KVS0001 increased the presentation of immune-targetable HLA class I-associated peptides from nonsense-mediated decay (NMD)-downregulated proteins on the surface of cancer cells. KVS0001 exerts anti-tumor properties and can be studied in research for NMD-related diseases, including cancer and inherited diseases[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 3056394-59-0. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-161111. | |
| KW-2449 | KW-2449 is a multi-targeted kinase inhibitor of FLT3, ABL, ABLT315I and Aurora kinase with IC50s of 6.6, 14, 4 and 48 nM, respectively. Uses: Scientific research. Category: Signaling pathways. CAS No. 1000669-72-6. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-10339. | |
| KW-2478 | KW-2478 is an HSP90 inhibitor (IC50 = 3.8 nM). KW-2478 inhibits the growth and induces apoptosis in chronic myeloid leukemia (CML) cells and liver cancer cells. KW-2478 weakens the BCR/ABL and MAPK signaling pathways, leading to increased p27 and p21 expression and decreased cyclin B1 expression. KW-2478 downregulates STAT3 expression. KW-2478 may be used in research on cancers such as CML and liver cancer[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 819812-04-9. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-13468. | |
| KW 3902 | KW 3902. Group: Biochemicals. Grades: Purified. CAS No. 136199-02-5. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| KWAR 23 | KWAR23 is an anti-human SIRPα antibody. KWAR23 binds human SIRPα with high affinity and disrupts its binding to CD47. KWAR23 shows antitumor activity in combination with tumor-opsonizing antibodies and can be used in cancer immunotherapy research[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2243227-60-1. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99175. | |
| KWG 1342 | KWG 1342. Group: Biochemicals. Alternative Names: 4-(4-Chlorophenoxy)-2,2-dimethyl-4-(1H-1,2,4-triazol-1-yl)-1,3-butanediol. Grades: Highly Purified. CAS No. 72699-18-4. Pack Sizes: 2.5mg. Molecular Formula: C14H18ClN3O3, Molecular Weight: 311.76. US Biological Life Sciences. | Worldwide |
| KWG 1342 Sulfate Sodium Salt | KWG 1342 Sulfate Sodium Salt. Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 1mg. Molecular Formula: C14H17ClN3NaO6S, Molecular Weight: 413.81. US Biological Life Sciences. | Worldwide |
| KX-01-191 | KX-01-191 (compound 5c) is a tin-precursor[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2211903-84-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-128721. | |
| KX2-361 | KX2-361 (KX-02) is a Src-kinase and tubulin polymerization inhibitor. KX2-361 shows good oral bioavailability and readily crosses the BBB in mice. KX2-361 shows anti-tumor activity and induces apoptosis of Glioblastoma (GBM) cell[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: KX-02. CAS No. 897016-26-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-111187. | |
| KY02111 | KY02111. Group: Biochemicals. Alternative Names: KY 02111, KY-02111, CHEMBL3186128, HY-13815, S-7828. Grades: Highly Purified. CAS No. 1118807-13-8. Pack Sizes: 10mg, 50mg. Molecular Formula: C18 H17 ClN 2O3, Molecular Weight: 376.9. US Biological Life Sciences. | Worldwide |
| KY 02111 | KY 02111. Group: Biochemicals. Grades: Purified. CAS No. 1118807-13-8. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| KY-02327 acetate | KY-02327 acetate, a metabolically stabilized KY-02061 analog, is a potent Dishevelled (Dvl)-CXXC5 interaction inhibitor. KY-02327 acetate shows an activating effect on the Wnt/β-catenin pathway, resulting in promotion of osteoblast differentiation[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2989396-34-9. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-124156A. | |
| KY-1044 | KY-1044 (Alomfilimab; SAR 445256) is a fully human IgG1 antibody targeting inducible costimulatory receptor (ICOS). KY-1044 depletes ICOShigh cells via antibody-dependent cellular cytotoxicity (ADCC) through the engagement of FcgRIIIa. KY-1044 act as a costimulatory molecule on cells expressing lower ICOS levels, such as CD8+ TEff cells (through FcgR-dependent clustering). KY-1044 exploit the differential expression of ICOS on T-cell subtypes to improve the intratumoral immune contexture and restore an antitumor immune response[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: Alomfilimab; SAR 445256. CAS No. 2489390-15-8. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P99431. | |
| KY19382 | KY19382 is a potent and orally active dual inhibitor of CXXC5-DVL and GSK3β, with IC50s of 19 and 10 nM, respectively. KY19382 activates Wnt/β-catenin signaling through inhibitory effects on both CXXC5-DVL interaction and GSK3β activity. KY19382 can be used for the research of high fat diet (HFD) induced metabolic diseases[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: A3051. CAS No. 2226664-93-1. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-131447. | |
| KY386 | KY386 is a DHX33 helicase inhibitor with an IC50 of 0.019 μM. KY386 inhibits the cell viability of various cancer cells. KY386 induces ferroptosis in cancer cells, and induces apoptosis in some cancer cell lines. KY386 increases the intracellular levels of ROS, LPO and Fe2+, and decreases the level of GSH in cancer cells. KY386 inhibits the growth of gastric cancer and colon cancer xenografts in nude mice. KY386 is applicable to the related research on liver cancer, lung cancer, pancreatic cancer, colorectal cancer, gastric cancer, breast cancer, leukemia, renal cancer, prostate cancer, esophageal cancer, cervical cancer, brain cancer (glioblastoma) and melanoma[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2787598-01-8. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-156418. | |
| KYL | KYL is a selective and potent EphA4 receptor tyrosine kinase antagonist with Kd value of 0.8 μM. It inhibits EphA4-EphrinA5 interactions with IC50 value of 6.34 μM. It prevents AβO induced dendritic spine loss and synaptic damage. It also prevents the blocking of LTP in hippocampal CA3-CA1 transmissions. It shows a long half life in cell culture media. It has the neuroprotective effect. Synonyms: H-Lys-Tyr-Leu-Pro-Tyr-Trp-Pro-Val-Leu-Ser-Ser-Leu-OH; L-lysyl-L-tyrosyl-L-leucyl-L-prolyl-L-tyrosyl-L-tryptophyl-L-prolyl-L-valyl-L-leucyl-L-seryl-L-seryl-L-leucine; HY-P2264. Grade: ≥95%. CAS No. 676657-00-4. Molecular formula: C74H108N14O17. Mole weight: 1465.75. | |
Our database is helping our users find suppliers everyday.
