A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| Kresoxim-methyl Impurity 4 | Kresoxim-methyl Impurity 4. Uses: For analytical and research use. CAS No. 141517-21-7. Molecular formula: C20H19F3N2O4. Mole weight: 408.38. Catalog: APB141517217. |  |
| Kresoxim-methyl Impurity 5 | Kresoxim-methyl Impurity 5. Uses: For analytical and research use. CAS No. 149961-52-4. Molecular formula: C19H22N2O3. Mole weight: 326.39. Catalog: APB149961524. | |
| KRIBB11 | KRIBB11. Group: Biochemicals. Grades: Purified. CAS No. 342639-96-7. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. |  Worldwide |
| KRIBB11 | KRIBB11 is an inhibitor of Heat shock factor 1 (HSF1), with IC50 of 1.2 μM. Uses: Scientific research. Category: Signaling pathways. CAS No. 342639-96-7. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-100872. |  |
| KRM-III | KRM-III is a potent and orally active T-cell antigen receptor (TCR) inhibitor. KRM-III inhibits TCR- and phorbol myristate acetate/ionomycin-induced activation of nuclear factor of activated T cells (NFAT) and T-cell proliferation with an IC50 of ~5 μM. Anti-inflammatory activity[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 79220-94-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-136427. | |
| KRN2 | KRN2 is a selective inhibitor of nuclear factor of activated T cells (NFAT5), with an IC50 of 100 nM. KRN2 has potential to treat NFAT5-mediated Chronic Arthritis[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 248260-75-5. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-112125. | |
| KRN5500 | KRN5500 is a semisynthetic derivative of the nucleoside-like antineoplastic antibiotic spicamycin, originally isolated from the bacterium Streptomyces alanosinicus. KRN 5500 inhibits protein synthesis by interfering with endoplasmic reticulum and Golgi apparatus functions. This agent also induces cell differentiation and caspase-dependent apoptosis. Alternative Names: KRN-5500; KRN 5500; SPK-241; SPK241; SPK 241; NSC-650426; 4-Deoxy-N-(7H-purin-6-yl)-4-(((2,4-tetradecadienoylamino)acetyl)amino)heptopyranosylamine. CAS No. 151276-95-8. Molecular formula: C28H43N7O7. Mole weight: 589.69. |  |
| KRN7000 | KRN7000 is a synthetic analog of α-galactosylceramide and the marine natural product agelasphin. It is a specific ligand for human and mouse NKT cells and remains the best studied ligand of the lipid-binding MHC class I-like protein CD1d. It protects against LPS-induced shock and displays potent antitumor activity in various in vivo models. Alternative Names: a-Gal-Cer; N-[(1S,2S,3R)-1-[(a-D-Galactopyranosyloxy)methyl]-2,3-dihydroxyheptadecyl]hexacosanamide. Grades: ≥95%. CAS No. 158021-47-7. Molecular formula: C50H99NO9. Mole weight: 858.32. | |
| Kroll's Reagent | Excellent for titanium and alloys. |  |
| KRP-203 | KRP-203. Group: Biochemicals. Alternative Names: 2-Amino-2- [2- [2-chloro-4- [ [3- (phenylmethoxy) phenyl] thio] phenyl] ethyl] -1, 3-propanediol hydrochloride. Grades: Highly Purified. CAS No. 509088-69-1. Pack Sizes: 50mg, 100mg. Molecular Formula: C24H27Cl2NO3S. US Biological Life Sciences. | Worldwide |
| KRpep-2d | KRpep-2d is a K-Ras(G12D) selective inhibitory cyclic peptide that has the potential as the treatment of cancers expressing K-Ras(G12C) mutant. Alternative Names: s8499. Molecular formula: C108H182N44O25S2. Mole weight: 2561.01. | |
| Kryptofix 221 | Kryptofix 221 is a biological material or organic compound that can be used in life science research[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 31364-42-8. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-D0883. | |
| KRYPTOFIX(R) 211 | Applications: 4,7,13,18-Tetraoxa-1,10-diazabicyclo[8.5.5]eicosane is a useful research chemical. Alternative Names: 4,7,13,18-TETRAOXA-1,10-DIAZABICYCLO[8.5.5]EICOSANE; KRYPTOFIX 211; KRYPTOFIX(R) 211; 4,7,13,18-tetraoxa-1,10-diazabicyclo[8.5.5]icosane; KRYPTOFIX 211 95+%; cryptating agent 211; [2.1.1]Cryptand; 4,10-(Ethylenebisoxybisethylene)-1,7-dioxa-4,10-diazacyclododeca. CAS No. 31250-06-3. Molecular formula: C14H28N2O4. Mole weight: 288.38. | |
| KRYPTOFIX(R) 221 | KRYPTOFIX(R) 221. Alternative Names: KRYPTOFIX 221; KRYPTOFIX(R) 221; 4,7,13,16,21-PENTAOXA-1,10-DIAZABICYCLO[8.8.5]TRICOSANE; 4,7,16,21-Pentaoxa-1,10-diazabicyclo[8.8.5.]tricosane; 4,7,13,16,21-pentaoxa-1,10-*diazabicyclo(8.8.5)tr; 4,7,13,16,21-pentaoxa-1,10-diazabicylco-(8.8.5)tricosane. Grades: 95%. CAS No. 31364-42-8. Molecular formula: C16H32N2O5. Mole weight: 332.44. | |
| KS100 | KS100 is a potent ALDH inhibitor with IC50s of 230, 1542, 193 nM for ALDH1A1, ALDH2, and ALDH3A1, respectively. KS100 shows antiproliferative and anticancer effects with low low toxic. KS100 significantly increases ROS activity, lipid peroxidation and toxic aldehyde accumulation. KS10600 induces apoptosis and cell cycle arrest at the G2/M phase[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2408477-54-1. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-146682. | |
| KS-133 | KS-133 is a bicyclic peptide with VIPR2 antagonistic activity that can cross the blood-brain barrier. KS-133 selectively blocks VIPR2-mediated Gq/Ca, Gs/cAMP, cAMP/PKA/ERK and PI3K/AKT/GSK3β signaling pathways. KS-133 inhibits VIPR2 agonist-induced CREB phosphorylation in the prefrontal cortex of mice. KS-133 shifts the polarization direction of macrophages toward M1. KS-133 attenuates cancer cell proliferation and reduces the cell cycle distribution level at the S-M phase. KS-133 exerts antitumor effects in a mouse model of colorectal cancer. KS-133 reverses cognitive decline in mouse models of psychiatric disorders. KS-133 can be used for research related to schizophrenia, colorectal cancer and breast cancer[1][2][3][4]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2724212-01-3. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-P6292. | |
| KS15 | KS15 is an inhibitor of the interactions between cryptochromes (CRYs: CRY1 and CRY2) and the CLOCK:BMAL1 heterodimer. KS15 impairs the feedback actions of CRYs on E-box-dependent transcription (EC50=4.9 μM) by CLOCK:BMAL1 heterodimer, an indispensable transcriptional regulator of the mammalian circadian clock. Anti-proliferative activity[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1033781-20-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-115672. | |
| KS176 | KS176 is a selective BCRP inhibitor (IC50 values are 0.59 and 1.39 μM in Pheo A and Hoechst assays, respectively). KS176 can be used in the research of cancer[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1253452-78-6. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-19753. | |
| KS 176 | KS 176. Group: Biochemicals. Grades: Purified. CAS No. 1253452-78-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| KS2100 Hydrogenated rosin resin | KS2100 Hydrogenated rosin resin. | |
| KS-501 | It is produced by the strain of Sporothrix sp. KAC-1989. KS-501 inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of 1.8 μmol/L. Alternative Names: KS 501; 3-Heptyl-5-hydroxyphenyl 2-heptyl-6-(hexofuranosyloxy)-4-hydroxybenzoate. CAS No. 120634-86-8. Molecular formula: C33H48O10. Mole weight: 604.73. | |
| KS 502 | It is produced by the strain of Sporothrix sp. KAC-1989. KS 502 inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of 4.4 μmol/L. Alternative Names: Benzoic acid, 2-(beta-D-galactofuranosyloxy)-6-heptyl-4-hydroxy-, 4-carboxy-3-heptyl-5-hydroxyphenyl ester. Grades: >98%. CAS No. 120634-85-7. Molecular formula: C34H48O12. Mole weight: 648.74. | |
| KS 504a | It is produced by the strain of Mollisia ventosa KAC-1148. KS 504a inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of 122 μmol/L. Alternative Names: KS-504a; KS-504b; BRN 4354490; 1-Oxaspiro(2.4)heptan-5-ol, 2,4,4,6,6-pentachloro-7-(dichloromethylene)-. CAS No. 122022-77-9. Molecular formula: C7H3Cl7O2. Mole weight: 367.27. | |
| KS-504d | It is produced by the strain of Mollisia ventosa KAC-1148. KS-504d inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of >500 μmol/L. Alternative Names: KS 504d; BRN 4322179; (+)-1-(Dichloromethyl)-5-(dichloromethylene)-2,2,4,4-tetrachloro-1,3-cyclopentanediol. CAS No. 122005-23-6. Molecular formula: C7H4Cl8O2. Mole weight: 403.73. | |
| KS-504e | It is produced by the strain of Mollisia ventosa KAC-1148. KS-504e inhibited Ca2+ and calmodulin dependent cyclic-nucleotide phosphodiesterase with an IC50 of 139 μmol/L. Alternative Names: KS 504e; BRN 4321107; (+)-4-Hydroxy-3,3,5,5-tetrachloro-2-(trichloromethyl)-1-cyclopentene-1-carboxaldehyde; 1-Cyclopentene-1-carboxaldehyde, 3,3,5,5-tetrachloro-4-hydroxy-2-(trichloromethyl)-, (+)-. CAS No. 122006-32-0. Molecular formula: C7H3Cl7O2. Mole weight: 367.27. | |
| KS-619-1 | It is produced by the strain of Streptomyces californicus KS-619-1. KS-619-1 inhibited Ca2+ and CAM-PDE in bovine brain and heart with an IC50 of 2.0 and 1.5 μmol/L. Alternative Names: KS 619-1; Benzo(a)naphthacene-2-carboxylic acid, 5,6,8,13-tetrahydro-1,7,9,11-tetrahydroxy-8,13-dioxo-3-(2-oxopropyl)-. CAS No. 103370-21-4. Molecular formula: C26H18O9. Mole weight: 474.41. | |
| KSC-34 | KSC-34, a covalent modifier of protein disulfide isomerase A1 (PDIA1), is also a selective and potent a-site inhibitor of PDIA1 with an IC50 of 3.5 μM. KSC-34 displays a 30-fold selectivity for a domain over a domain and displays high selectivity for PDIA1 in complex proteomes with minimal engagement of other members of the PDI family[1]. KSC-34 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Category: Signaling pathways. CAS No. 2226201-97-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-117570. | |
| KSI-3716 | KSI-3716 is a potent c-Myc inhibitor that blocks c-MYC/MAX binding to target gene promoters. KSI-3716 is an effective intravesical chemotherapy agent for bladder cancer[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1151813-61-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12703. | |
| Ksp22 I | One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 20-fold overdigestion with enzyme more than 90% of the dna fragments can be ligated and recut. Group: Restriction Enzymes. Purity: 1000U; 5000U. T↑GATCA ACTAG↓T. Activity: 20000u.a./ml. Appearance: 10 X SE-buffer 2K, BSA. Storage: -20°C. Form: Liquid. Source: Kurthia species 22. Pack: 10 mM Tris-HCl (pH 7.5); 250 mM NaCl; 0.1 mM EDTA; 7 mM 2-mercaptoethanol; 200 μg/ml BSA, 50% glycerol. Cat No: ET-1126RE. |  |
| KSPWFTTL | KSPWFTTL is an immunodominant Kb-restricted epitope from the p15E transmembrane protein. KSPWFTTL can restore susceptibility of a tumor line to anti-AKR/Gross MuLV cytotoxic T lymphocytes[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 153049-05-9. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3333. | |
| KSQ-4279 | KSQ-4279 (USP1-IN-1) is a potent USP1 inhibitor and a selective PARP1 inhibitor. KSQ-4279 is promising for research of cancers[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: USP1-IN-1. CAS No. 2446480-97-1. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145471. | |
| KT109 | KT109 is a potent and an isoform-selective inhibitor of diacylglycerol lipase-β (DAGLβ) with an IC50 of 42 nM. KT109 has ~60-fold selectivity for DAGLβ over DAGLα. KT109 shows inhibitory activity against PLA2G7 (IC50=1 μM). KT109 shows negligible activity against FAAH, MGLL, ABHD11, and cytosolic phospholipase A2 (cPLA2 or PLA2G4A). KT109 perturbs a lipid network involved in macrophage inflammatory responses and lowers 2-Arachidonoylglycerol (HY-W011051), Arachidonic acid (HY-109590) and eicosanoids in mouse peritoneal macrophages[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1402612-55-8. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-18540. | |
| KT172 | KT172 is a DAGLβ inhibitor with an IC50 value of 11 nM. KT172 can be used for the research of metabolic and inflammatory[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1402612-56-9. Pack Sizes: 1 mg; 5 mg; 10 mg. Product ID: HY-18541. | |
| KT-333 | KT-333 is a molecular glues that degrades STAT3 protein. KT-333 mediates the selective degradation of STAT3 through the ubiquitin-proteasome system by binding to STAT3 protein and E3 ubiquitin ligase von Hippel-Lindau protein (VHL). KT-333 has strong selectivity for STAT3 protein degradation and good antitumor activity. KT-333 can be used in the study of hematologic malignancies such as large granular lymphocytic leukemia (LGL-L), peripheral T-cell lymphoma (PTCL), and cutaneous T-cell lymphoma (CTCL)[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2502186-79-8. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg. Product ID: HY-156730. | |
| KT-474 | KT-474 (KYM-001; PROTAC IRAK4 degrader-7) is an orally active PROTAC IRAK4 degrader with anti-tumor effects. KT-474 inhibits the cell cycle and induces apoptosis. KT-474 induces tumor regression in a xenograft model of MYD88-mutated ABC DLBCL. KT-474 is a click chemistry reagent, containing an alkyne group, which can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing azide groups[1][2][3]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: KYM-001; PROTAC IRAK4 degrader-7. CAS No. 2432994-31-3. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-145483. | |
| KT5720 | KT5720 is a potent, cell-permeable, specific, reversible and ATP-competitive PKA inhibitor (IC50=3.3 μM). KT5720 is effective in reversing MDR1-mediated multidrug resistance. KT5720 also reduces the excitability of dorsal root ganglion (DRG) neurons by attenuating Hyperpolarization-activated cyclic nucleotide-gated (HCN) channel activity and reducing intracellular Ca2+ concentrations. KT5720 can be used in the study of haematological malignancies as well as HCN and DRG neuron-related diseases[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 108068-98-0. Pack Sizes: 50 μg; 100 μg. Product ID: HY-N6789. | |
| KT5720 | KT 5720, an anti-bacterial agent synthesized by the fungus Nocardiopsis sp, specifically blocks PKA signaling through competitive inhibition of ATP with a Ki value of 60 nM. Uses: Anti-bacterial agents. Alternative Names: 2,3,9,10,11,12-hexahydro-10S-hydroxy-9-methyl-1-oxo-9R,12S-epoxy-1H-diindolo[1,2,3-fg:3',2',1'-kl]pyrrolo[3,4-i][1,6]benzodiazocine-10-carboxylic acid, hexyl ester; KT 5720; KT5720; KT-5720. Grades: 98%. CAS No. 108068-98-0. Molecular formula: C32H31N3O5. Mole weight: 537.60. | |
| KT 5720 | KT 5720. Group: Biochemicals. Grades: Purified. CAS No. 108068-98-0. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| KT5823 | KT 5823 is a cell-permeable, selective inhibitor of cGMP-dependent protein kinase (PKG) (Ki values are 0.23, 4 and > 10 μM for inhibition of PKG, PKC and PKA respectively). KT 5823 is often used in intact cells to assess the role of PKG in signaling, although there are cases where it poorly inhibits PKG in cells. Uses: Kt5823 induces apoptotic fragmentation of dna. Alternative Names: KT 5823; KT-5823; KT5823; 2,3,9,10,11,12-hexahydro-10R-methoxy-2,9-dimethyl-1-oxo-9S,12R-epoxy-1H-diindolo[1,2,3-fg:3',2',1'-kl]pyrrolo[3,4-i][1,6]benzodiazocine-10-carboxylic acid, methyl ester. Grades: ≥98%. CAS No. 126643-37-6. Molecular formula: C29H25N3O5. Mole weight: 495.52. | |
| KT5823 | KT5823, a selective the cGMP-dependent protein kinase (PKG) inhibitor with an Ki value of 0.23 μM, it also inhibits PKA and PKC with Ki values of 10 μM and 4 μM, respectively. KT5823 is a Staurosporine-related protein kinase inhibitor, increases thyroid-stimulating hormone-induced (Na+/I- symporter) NIS expression, and iodide uptake in thyroid cells. KT5823 arrests cells after the G0/G1 boundary and causes increases in the levels of apoptotic DNA fragmentation[1][2][3][4][5]. Uses: Scientific research. Category: Signaling pathways. CAS No. 126643-37-6. Pack Sizes: 100 μg; 500 μg; 1 mg; 5 mg. Product ID: HY-N6791. | |
| KT 5823 | KT 5823. Group: Biochemicals. Grades: Purified. CAS No. 126643-37-6. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| KTC1101 | KTC1101 is an orally active pan-PI3K inhibitor. KTC1101 can inhibit the PI3K signaling pathway, reduce downstream AKT and mTOR phosphorylation, and reduces the expression of Ki67. The anti-tumor effect of KTC1101 has a dual mechanism of action: directly inhibiting tumor cell growth and dynamically enhancing immune response[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2764833-47-6. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-162382. | |
| K+-transporting ATPase | A P-type ATPase that undergoes covalent phosphorylation during the transport cycle. A bacterial enzyme of di(heterotetrameric) structure that is involved in K+ import. The probable stoichiometry is one ion per ATP hydrolysed. Group: Enzymes. Synonyms: K+-translocating Kdp-ATPase; multi-subunit K+-transport ATPase. Enzyme Commission Number: EC 7.2.2.6 (Formerly EC 3.6.3.12). Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4649; K+-transporting ATPase; EC 3.6.3.12; K+-translocating Kdp-ATPase; multi-subunit K+-transport ATPase. Cat No: EXWM-4649. | |
| KTRNQMSFKETNGLEKIFQDHPLQKTYNYNVLMVPKQ | KTRNQMSFKETNGLEKIFQDHPLQKTYNYNVLMVPKQ. Alternative Names: Lys-Thr-Arg-Asn-Gln-Met-Ser-Phe-Lys-Glu-Thr-Asn-Gly-Leu-Glu-Lys-Ile-Phe-Gln-Asp-His-Pro-Leu-Gln-Lys-Thr-Tyr-Asn-Tyr-Asn-Val-Leu-Met-Val-Pro-Lys-Gln. Molecular formula: C199H315N55O58S2. Mole weight: 4470.16. | |
| KU-0058948 | KU-0058948 is a poly (ADP-ribose) polymerase (PARP) inhibitor. Studies show that KU-0058948 a potent agonist that activates transfected extracellular signal-regulated kinase 8 (ERK8) in cells. KU-0058948 induces cell cycle arrest and apoptosis of primary myeloid leukemic cells and myeloid leukemic cell lines in vitro. Group: Biochemicals. Alternative Names: 4- [ [4-fluoro-3- [ (hexahydro-1H-1, 4-diazepin-1-yl) carbonyl] phenyl] methyl] -1 (2H) -phthalazinone; KU 0058948; KU0058948; 1- [5- [ (3, 4-dihydro-4-oxo-1-phthalazinyl) methyl] -2-fluorobenzoyl] hexahydro-1H-1, 4-diazepine. Grades: Highly Purified. CAS No. 763111-49-5. Pack Sizes: 10mg. US Biological Life Sciences. | Worldwide |
| KU 0060648 | Dual PI 3-K and DNA-PK inhibitor (IC50 values are <0.1, 0.5, 4 and 19 nM for PI 3-Kdelta, PI 3-Kbeta, PI 3-Kalpha and DNA-PK respectively). Inhibits proliferation of MCF7 cells in vitro and delays growth of MCF7 xenografts in mice. Also enhances CRISPR-Cas9-mediated homology- directed repair (HDR) efficiency, and attenuates nonhomologous end-joining (NHEJ). Group: Biochemicals. Alternative Names: 4-Ethyl-N-[4-[2-(4-morpholinyl)-4-o xo-4H-1-benzopyran-8-yl]-1-dibenzothienyl]-1-piper azineacetamide. Grades: Highly Purified. CAS No. 881375-00-4. Pack Sizes: 10mg. Molecular Formula: C??H??N?O?S, Molecular Weight: 582.71. US Biological Life Sciences. | Worldwide |
| KU-0060648 | KU-0060648 is a dual inhibitor of PI3K and DNA-PK with IC50s of 4 nM, 0.5 nM, 0.1 nM, 0.594 nM and 8.6 nM for PI3Kα, PI3Kβ, PI3Kγ, PI3Kδ and DNA-PK, respectively[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 881375-00-4. Pack Sizes: 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-13431. | |
| Ku-0063794 | KU-0063794 is an inhibitor of both mTORC1 and mTORC2 with an IC50 of approximately 10 nM, but does not suppress the activity of 76 other protein kinases or seven lipid kinases, including Class 1 PI3Ks (phosphoinositide 3-kinases) at 1000-fold higher concentrations. KU-0063794 is cell permeant, suppresses activation and hydrophobic motif phosphorylation of Akt, S6K and SGK, but not RSK (ribosomal S6 kinase), an AGC kinase not regulated by mTOR. It also inhibited phosphorylation of the T-loop Thr308 residue of Akt phosphorylated by PDK1 (3-phosphoinositide-dependent protein kinase-1). It does not affect Thr308 phosphorylation in fibroblasts lacking essential mTORC2 subunits. KU-0063794 also suppressed cell growth and induced a G1-cell-cycle arrest. KU-0063794 will be useful in delineating the physiological roles of mTOR and may have utility in treatment of cancers in which this pathway is inappropriately activated. Uses: Differentiation. Alternative Names: KU0063794; KU-0063794; KU 0063794; Ku0063794; Ku 0063794; Ku-0063794; KU63794; KU 63794; KU-63794; [5-[2-[(2R,6S)-2,6-dimethylmorpholin-4-yl]-4-morpholin-4-ylpyrido[2,3-d]pyrimidin-7-yl]-2-methoxyphenyl]methanol. Grades: 0.98. CAS No. 938440-64-3. Molecular formula: C25H31N5O4. Mole weight: 465.554. | |
| KU-0063794 | KU-0063794 is a potent and specific mTOR inhibitor, inhibiting both the mTORC1 and mTORC2 complexes with IC50s of 10 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 938440-64-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-50710. | |
| KU14R | KU14R. Group: Biochemicals. Grades: Purified. CAS No. 189224-48-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| KU-55933 | KU-55933 is a potent and specific ATM inhibitor with IC50/Ki of 12.9 nM/2.2 nM in cell-free assays, and is highly selective for ATM as compared to DNA-PK, PI3K/PI4K, ATR and mTOR. KU - 55933 (ATM Kinase Inhibitor) inhibits the activation of autophagy - initiating kinase ULK1 and results in a significant decrease of autophagy. Group: Inhibitors. Alternative Names: ATM Kinase Inhibitor. CAS No. 587871-26-9. Pack Sizes: 5mg. Product ID: S1092. Formula: C21H17NO3S2. Smiles: C1COCCN1C2=CC(=O)C=C(O2)C3=C4C(=CC=C3)SC5=CC=CC=C5S4. Storage Conditions: 2 years -80 in solvent. |  United States; Europe |
| KU-55933 | KU-55933 is a potent ATM inhibitor with an IC50 and Ki of 12.9 and 2.2 nM, respectively, and is highly selective for ATM as compared to DNA-PK, PI3K/PI4K, ATR and mTOR. Uses: Scientific research. Category: Signaling pathways. CAS No. 587871-26-9. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg. Product ID: HY-12016. | |
| KU-57788 | KU-57788 (NU7441) is a highly potent and selective DNA-PK inhibitor with an IC50 of 14 nM. KU-57788 is an NHEJ pathway inhibitor. KU-57788 also inhibits PI3K and mTOR with IC50s of 5.0 and 1.7 μM, respectively[1]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: NU7441. CAS No. 503468-95-9. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg; 500 mg. Product ID: HY-11006. | |
| KU 59403 | KU 59403 is a potent ATM inhibitor, with IC50 values of 3 nM, 9.1 μM and 10 μM for ATM, DNA-PK and PI3K, respectively[1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 845932-30-1. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg. Product ID: HY-18650. | |
| KU-60019 | KU-60019 is an improved analogue of KU-55933, with IC50 of 6.3 nM for ATM in cell-free assays, 270- and 1600-fold more selective for ATM than DNA-PK and ATR,and is a highly effective radiosensitizer. Group: Inhibitors. CAS No. 925701-49-1. Pack Sizes: 10mg. Product ID: S1570. Formula: C30H33N3O5S. Smiles: CC1CN(CC(O1)C)CC(=O)NC2=CC3=C(C=C2)SC4=C(C3)C=CC=C4C5=CC(=O)C=C(O5)N6CCOCC6. Storage Conditions: 2 years -80 in solvent. | United States; Europe |
| KU-60019 | KU-60019 is an improved ATM kinase-specific inhibitor with IC50 of 6.3 nM. Uses: Scientific research. Category: Signaling pathways. CAS No. 925701-46-8. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg. Product ID: HY-12061. | |
| KU-60019 | KU-60019 is a potent and selective ATM inhibitor. KU-60019 is 10-fold more effective than KU-55933 at blocking radiation-induced phosphorylation of key ATM targets in human glioma cells. As expected, KU-60019 is a highly effective radiosensitizer of human glioma cells. KU-60019 inhibits the DNA damage response, reduces AKT phosphorylation and prosurvival signaling, inhibits migration and invasion, and effectively radiosensitizes human glioma cells. Alternative Names: KU60019; KU 60019; 2-((2R,6S)-2,6-dimethylmorpholino)-N-(5-(6-morpholino-4-oxo-4H-pyran-2-yl)-9H-thioxanthen-2-yl)acetamide. Grades: 98%. CAS No. 925701-49-1. Molecular formula: C30H33N3O5S. Mole weight: 547.67. | |
| Ku70 | KU70 is a cell-penetrating peptide used to block the activity of KU70 antibody. Alternative Names: H-Val-Pro-Met-Leu-Lys-Pro-Met-Leu-Lys-Glu-OH; L-valyl-L-prolyl-L-methionyl-L-leucyl-L-lysyl-L-prolyl-L-methionyl-L-leucyl-L-lysyl-L-glutamic acid. Grades: >98%. Molecular formula: C54H96N12O13S2. Mole weight: 1185.55. | |
| Kuanoniamine c | Kuanoniamine c. Alternative Names: KUANONIAMIME C;kuanoniamine c from oceanappia sp. CAS No. 133401-11-3. Product ID: ACM133401113. Molecular formula: C21H18N4OS. Mole weight: 360.483. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| Kudzu Extract | Kudzu root extract is extracted from the plant in the genus pueraria in the pea family Fabaceae, subfamily faboideae. In traditional Chinese medicine, kudzu root extract puerarin is used in prescriptions for the treatment of thirst, headache, and stiff neck with pain due to high blood pressure. Kudzu root extract, also known as radix puerariae extract, contains a variety of phytochemicals, which are potent antioxidant compounds found naturally in plants, that help to prevent and treat human disease. Group: Others. Mole weight: 416.38. Kudzu Extract; Pueraria Edulis Pampan. Cat No: EXTC-013. | |
| Kudzu Root Extract (Standard) | Kudzu root has been known for centuries in traditional Chinese medicine as ge-gen. The first written mention of the plant as a medicine is in the ancient herbal text of Shen Nong (about A.D.100). In traditional Chinese medicine, kudzu root is used in prescriptions for the treatment of thirst, headache, and stiff neck with pain due to high blood pressure. It is also recommended for allergies, migraine headaches, inadequate measles eruptions in children, and diarrhea It is also used in modern Chinese medicine as a treatment for angina pectoris. Applications: Kudzu root extract is used as remedy for diaphoretic,antispasmodic,muscle relaxant,antipyretic.kudzu root extract is also used for fevers caused by heat in colds and influenza and for stiff neck and shoulders. Group: Others. CAS No. Puerarin: 3681-99-0Genistein: 446-72-0Daidzin: 552-66-9Daidzein: 486-66-8. Purity: 40.0% Isoflavones UV/HPLC. Mole weight: Puerarin: 416.37Genistein: 270.23Daidzin: 416.38Daidzein: 254.23. Kudzu Root Extract (Standard); Puerarin: 3681-99-0Genistein: 446-72-0Daidzin: 552-66-9Daidzein: 486-66-8; Puerarin: C21H20O9Genistein: C15H10O5Daidzin: C21H20O9Daidzein: C10H15O4. Cat No: EXTW-008. | |
| Kukoamine A | Kukoamine A is a spermine alkaloid isolated from Lycium chinense, potatoes, and tomatoes. It exhibits diverse biological activities, including anticancer, neuroprotective, and anti-inflammatory properties. Kukoamine A inhibits human glioblastoma cell growth and migration via apoptosis induction and epithelial-mesenchymal transition attenuation mediated by downregulating expressions of 5-LOX and C/EBPβ. Alternative Names: N1,N2-bis(dihydrocaffeoyl)spermine; 1,14-Bis(dihydrocaffeoyl)spermidine; N,N'-[1,4-butanediylbis(imino-3,1-propanediyl)]bis[3,4-dihydroxy-benzenepropanamide]. Grades: ≥95%. CAS No. 75288-96-9. Molecular formula: C28H42N4O6. Mole weight: 530.66. | |
| Kukoamine A | Kukoamine A. Group: Biochemicals. Grades: Plant Grade. CAS No. 75288-96-9. Pack Sizes: 10mg. Molecular Formula: C28H42N4O6, Molecular Weight: 530.66. US Biological Life Sciences. | Worldwide |
| Kukoamine A | Kukoamine A, a spermine alkaloid, is an orally active and brain-penetrant component found in the root barks of Lycium chinense (L. chinense) Miller. Kukoamine A inhibits purified Crithidia fasciculata trypanothione reductase and soybean lipoxygenase, activates μ-opioid receptor. Kukoamine A can inhibt cancer cell proliferation, migration and invasion, cause G0/G1 phase cell cycle arrest and induce apoptosis. Kukoamine A exerts neuroprotective effect and can induce autophagy. Kukoamine A inhibits LPS (HY-D1056)-induced NO, ROS, PGE2, TNF-α, IL-1β, IL-6 production and COX-2 activity. Kukoamine A reverses palmitic acid-induced insulin resistance, lipid accumulation, and oxidative stress via downregulation of Srebp-1c. Kukoamine A can be used for the research of cancer, infection, inflammation, metabolic and neurological disease, such as glioblastoma and Parkinson's disease[1][2][3][4][5][6][7]. Uses: Scientific research. Category: Signaling pathways. CAS No. 75288-96-9. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg. Product ID: HY-N2392. | |
| Kukoamine A-[d8] DiHCl | Kukoamine A-[d8] DiHCl. | |
| Kukoamine B | Kukoamine B. Group: Biochemicals. Grades: Plant Grade. CAS No. 164991-67-7. Pack Sizes: 10mg. Molecular Formula: C28H42N4O6, Molecular Weight: 530.66. US Biological Life Sciences. | Worldwide |
| KukoaMine B Impurity 4 | KukoaMine B Impurity 4. Uses: For analytical and research use. Molecular formula: C26H30N4O4. Mole weight: 462.55. Catalog: APB12259. | |
| KukoaMine Impurity 1 | KukoaMine Impurity 1. Uses: For analytical and research use. Molecular formula: C26H28O4. Mole weight: 404.51. Catalog: APB12258. | |
| KukoaMine Impurity 2 | KukoaMine Impurity 2. Uses: For analytical and research use. Molecular formula: C66H74N4O9. Mole weight: 1067.34. Catalog: APB12257. | |
| KukoaMine Impurity 3 | KukoaMine Impurity 3. Uses: For analytical and research use. Molecular formula: C64H70N4O8. Mole weight: 1023.28. Catalog: APB12260. | |
Our database is helping our users find suppliers everyday.
