A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Search for products or services, then visit the suppliers website for prices or more information.
| Product | Description | |
|---|---|---|
| protoporphyrinogen oxidase | This is the last common enzyme in the biosynthesis of chlorophylls and heme. Two isoenzymes exist in plants: one in plastids and the other in mitochondria. This is the target enzyme of phthalimide-type and diphenylether-type herbicides. The enzyme from oxygen-dependent species contains FAD. Also slowly oxidizes mesoporphyrinogen IX. Group: Enzymes. Synonyms: protoporphyrinogen IX oxidase; protoporphyrinogenase; PPO; Protox; HemG; HemY. Enzyme Commission Number: EC 1.3.3.4. CAS No. 53986-32-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-1378; protoporphyrinogen oxidase; EC 1.3.3.4; 53986-32-6; protoporphyrinogen IX oxidase; protoporphyrinogenase; PPO; Protox; HemG; HemY. Cat No: EXWM-1378. |  |
| PROTO_PROSY Protonectin | PROTO_PROSY Protonectin is an antimicrobial peptide found in Protonectarina sylveirae (Brazilian wasp), and has antibacterial activity against both gram-positive and gram-negative bacteria. It shows potent histamine releasing activities on rat peritoneal mast cells. Alternative Names: Ile-Leu-Gly-Thr-Ile-Leu-Gly-Leu-Leu-Lys-Gly-Leu; Protonectin. Grades: ≥96%. Molecular formula: C58H107N13O14. Mole weight: 1210.57. |  |
| Protopseudohypericin | Protopseudohypericin. Group: Biochemicals. Grades: Plant Grade. CAS No. 54328-09-5. Pack Sizes: 10mg. Molecular Formula: C30H18O9, Molecular Weight: 522.46. US Biological Life Sciences. |  Worldwide |
| Protosappanin B | Protosappanin B. Group: Biochemicals. Grades: Plant Grade. CAS No. 102036-29-3. Pack Sizes: 20mg. Molecular Formula: C16H16O6, Molecular Weight: 304.3. US Biological Life Sciences. | Worldwide |
| Protosappanin B | Protosappanin B is a natural compound found in the heart wood of Caesalpinia sappan L. Protosappanin B exhibits antitumor and anti-oxidant activity that can inhibit the oxidation of linoleic acid. Uses: Antitumor, anti-oxidant. Alternative Names: (-)-Protosappanin B; 6H-Dibenz[b,d]oxocin-3,7,10,11-tetrol, 7,8-dihydro-7-(hydroxymethyl)-, (7S,12aS)-. Grades: >95%. CAS No. 102036-29-3. Molecular formula: C16H16O6. Mole weight: 304.30. | |
| protostadienol synthase | (17Z)-Protosta-17(20),24-dien-3β-ol is a precursor of the steroidal antibiotic helvolic acid. Group: Enzymes. Synonyms: PdsA; (S)-2,3-epoxysqualene mutase [cyclizing, (17Z)-protosta-17(20),24-dien-3β-ol-forming]. Enzyme Commission Number: EC 5.4.99.32. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-5573; protostadienol synthase; EC 5.4.99.32; PdsA; (S)-2,3-epoxysqualene mutase [cyclizing, (17Z)-protosta-17(20),24-dien-3β-ol-forming]. Cat No: EXWM-5573. | |
| Protostemonine | Botanical Source: Group: Biochemicals. Grades: Plant Grade. CAS No. 27495-40-5. Pack Sizes: 10mg, 20mg. US Biological Life Sciences. | Worldwide |
| Protostemotinine | Formula: Group: Biochemicals. Grades: Plant Grade. CAS No. 169534-85-4. Pack Sizes: 5mg, 10mg. US Biological Life Sciences. | Worldwide |
| Protriptyline-d3 Hydrochloride | Protriptyline-d3 Hydrochloride. Group: Biochemicals. Alternative Names: N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine-d3 Hydrochloride; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine-d3 Hydrochloride; N-Methyl-5H-Dibenzo[a, d]cycloheptene-5-propylamine-d3 Hydrochloride; Concordin-d3; MK-240-d3; Maximed-d3; Maximet-d3; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propylamine-d3 Hydrochloride; Normethyl EX4442-d3; Protriptyline-d3 Hydrochloride; Protryptyline-d3 Hydrochloride; Triptil-d3 Hydrochloride; Vivactil-d3 Hydrochloride. Grades: Highly Purified. CAS No. 1435934-21-6. Pack Sizes: 1mg. Molecular Formula: C19H19D3ClN, Molecular Weight: 302.86. US Biological Life Sciences. | Worldwide |
| Protriptyline hydrochloride | Protriptyline hydrochloride is a potent tricyclic antidepressant (TCA). Protriptyline hydrochloride inhibits AChE activity with an IC50 value of 0.06 mM and inhibits Aβ self-assembly. Protriptyline hydrochloride can be used for the study of depression and Alzheimers disease[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 1225-55-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 250 mg. Product ID: HY-B0949. |  |
| Protriptyline Hydrochloride | Protriptyline hydrochloride is a secondary amine tricyclic antidepressant with activating properties, unlike the sedating effects of other TCAs. It is one of the least sedating agents in its class. The drug has a long half-life and is typically dosed once or twice daily. Applications: Protriptyline is indicated for major depressive disorder, particularly in patients with psychomotor retardation, apathy, or anergy. it is also used off-label for narcolepsy (to reduce cataplexy and excessive daytime sleepiness) and for attention-deficit/hyperactivity disorder (adhd) in children. Category: Active pharmaceutical ingredients. Synonyms: Protriptyline HCl; Concordin; Maximed; Triptil hydrochloride; MK-240; NSC-169912; DTXSID8046951. CAS No. 1225-55-4. Product ID: API0231626. Molecular formula: C19H22ClN. Mole weight: 299.8. EINECS: 214-956-3. InChIKey: OGQDIIKRQRZXJH-UHFFFAOYSA-N. Appearance: White to off-white powder. |  |
| Protriptyline Hydrochloride | Protriptyline Hydrochloride. Group: Biochemicals. Alternative Names: N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine Hydrochloride; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propanamine Hydrochloride; N-Methyl-5H-Dibenzo[a, d]cycloheptene-5-propylamine Hydrochloride; Concordin; MK-240; Maximed; Maximet; N-Methyl-5H-dibenzo[a, d]cycloheptene-5-propylamine Hydrochloride; Normethyl EX4442; Protriptyline hydrochloride; Protryptyline Hydrochloride; Triptil Hydrochloride; Vivactil Hydrochloride. Grades: Highly Purified. CAS No. 1225-55-4. Pack Sizes: 50mg. Molecular Formula: C19H22ClN, Molecular Weight: 299.839999999999. US Biological Life Sciences. | Worldwide |
| Pro-Trp-OH | Pro-Trp-OH. Group: Biochemicals. Grades: Reagent Grade. Pack Sizes: 100mg, 250mg. US Biological Life Sciences. | Worldwide |
| Pro-Trp-OH | Pro-Trp-OH. Alternative Names: L-Prolyl-L-tryptophan; Pro Trp OH. Grades: ≥ 99% (TLC). CAS No. 35310-39-5. Molecular formula: C16H19N3O3. Mole weight: 301.35. | |
| ProTx I | ProTx I, a toxin that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula), blocks native mouse CaV3.1 channel and recombinant human CaV3.1 channel currents similarly, and blocks to a lesser extent CaV3.2 and CaV3.3 channel currents. Alternative Names: ProTxI; ProTx-I; H-Glu-Cys(1)-Arg-Tyr-Trp-Leu-Gly-Gly-Cys(2)-Ser-Ala-Gly-Gln-Thr-Cys(3)-Cys(1)-Lys-His-Leu-Val-Cys(2)-Ser-Arg-Arg-His-Gly-Trp-Cys(3)-Val-Trp-Asp-Gly-Thr-Phe-Ser-OH; L-alpha-glutamyl-L-cysteinyl-L-arginyl-L-tyrosyl-L-tryptophyl-L-leucyl-glycyl-glycyl-L-cysteinyl-L-seryl-L-alanyl-glycyl-L-glutaminyl-L-threonyl-L-cysteinyl-L-cysteinyl-L-lysyl-L-histidyl-L-leucyl-L-valyl-L-cysteinyl-L-seryl-L-arginyl-L-arginyl-L-histidyl-glycyl-L-tryptophyl-L-cysteinyl-L-valyl-L-tryptophyl-L-alpha-aspartyl-glycyl-L-threonyl-L-phenylalanyl-L-serine (2->16),(9->21),(15->28)-tris(disulfide). Grades: >98%. CAS No. 484598-35-8. Molecular formula: C171H245N53O47S6. Mole weight: 3987.51. | |
| ProTx I | ProTx I. Group: Biochemicals. Grades: Purified. CAS No. 484598-35-8. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| ProTx-I | ProTx-I is a toxin derived from Thrixopelma pruriens and a peptide inhibitor targeting TTX-resistant sodium channels. ProTx-I interacts with voltage sensors of multiple domains such as NaV1.7, reduces neuronal excitability through allosteric modulation of channel gating and alteration of voltage dependence. The IC50 values of ProTx-I against human NaV1.7, NaV1.2, NaV1.6, and NaV1.5 are 95 nM, 104 nM, 21 nM, and 358 nM, respectively; ProTx-I also potently inhibits Ba2+ currents of hCav3.1, while its inhibitory potency against hCav3.2 is approximately 160-fold lower. ProTx-I is applicable to the research of chronic pain[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 484598-35-8. Pack Sizes: 100 μg; 500 μg; 1 mg; 5 mg. Product ID: HY-P1073. | |
| ProTx II | ProTx II. Group: Biochemicals. Grades: Purified. CAS No. 484598-36-9. Pack Sizes: 100ug. US Biological Life Sciences. | Worldwide |
| ProTx II | ProTx II is a selective NaV1.7 channel blocker with 100-fold selectivity over other sodium channel subtypes. Alternative Names: YCQKWMWTCDSERKCCEGMVCRLWCKKKLW. Grades: >98%. CAS No. 484598-36-9. Molecular formula: C168H250N46O41S8. Mole weight: 3826.59. | |
| ProTx III | ProTx III, isolated from the venom of the Peruvian green-velvet tarantula Thrixopelma pruriens, is a potent Nav1.7 blocker (IC50 = 2.5 nM) and also inhibits Nav1.1, Nav1.2, Nav1.3 and Nav1.6 in the nanomolar range. Alternative Names: DCLKFGWKCNPRNDKCCSGLKCGSNHNWCKLHI. Grades: >98%. Molecular formula: C162H246N52O43S6. Mole weight: 3802.41. | |
| Pro-Tyr-OH | Pro-Tyr-OH. Group: Biochemicals. Alternative Names: L-Prolyl-L-tyrosine. Grades: Highly Purified. CAS No. 19786-36-8. Pack Sizes: 100mg. US Biological Life Sciences. | Worldwide |
| Pro-Tyr-OH | Pro-Tyr-OH. Alternative Names: L-Prolyl-L-tyrosine; Pro Tyr OH. Grades: ≥ 99% (Assay). CAS No. 19786-36-8. Molecular formula: C14H18N2O4. Mole weight: 278.31. | |
| Pro-Urokinase from Human, recombinant | Urokinase or Urokinase-type plasminogen activator (uPA) is a serine protease (EC 3.4.21.73). It is secreted as a single-chain zymogen, pro-Urokinase, possessing little or no intrinsic enzymatic activity. The single chain zymogen is converted into the active two chain enzyme (tcuPA) by cleavage of the bond between Lys157 and Ile158. After activation, Urokinase specifically cleaves the proenzyme plasminogen to form the active enzyme plasmin. The active plasmin then catalyzes the breakdown of fibrin polymers of blood clots. Urokinase is involved in a number of biological functions including fibrinolysis, embryogenesis, cell migration, tissue remodeling, ovulation, and wound healing. Additionally, it is a potent marker of invasion and metastasis in a variety of human cancers associated with breast, stomach, colon, bladder, ovary, brain and endometrium. Group: Enzymes. Synonyms: Single chain Urokinase-type plasminogen activator; s. Purity: > 90% by SDS-PAGE. Pro-Urokinase. Mole weight: 49.3 kDa. Activity: >1200 mU/mg. Storage: Stable at -80°C for at least 1 year as supplied. Store reconstituted aliquots at -80°C. Avoid repeated freeze and thaw cycles. Form: Lyophilized powder. Source: E. coli. Species: Human. Single chain Urokinase-type plasminogen activator; scuPA; Urokinase-type Plasminogen Activator uPA; PLAU; Pro-Urokinase. Cat No: NATE-1689. | |
| Provean impurity 1 | Provean impurity 1. Uses: For analytical and research use. CAS No. 1932478-97-1. Molecular formula: C9H15NO2. Mole weight: 169.22. Catalog: APB1932478971. |  |
| Provean impurity 10 | Provean impurity 10. Uses: For analytical and research use. Molecular formula: C7H14ClN3O2. Mole weight: 207.66. Catalog: APB09234. | |
| Provean impurity 11 | Provean impurity 11. Uses: For analytical and research use. Molecular formula: C12H20N3O4-. Mole weight: 270.31. Catalog: APB09235. | |
| Provean impurity 12 | Provean impurity 12. Uses: For analytical and research use. CAS No. 2889532-79-8. Molecular formula: C7H14ClN3O2. Mole weight: 207.66. Catalog: APB2889532798. | |
| Provean impurity 2 | Provean impurity 2. Uses: For analytical and research use. CAS No. 1932411-98-7. Molecular formula: C9H15NO2. Mole weight: 169.22. Catalog: APB1932411987. | |
| Provean impurity 3 | Provean impurity 3. Uses: For analytical and research use. Molecular formula: C23H32F3N5O4. Mole weight: 499.54. Catalog: APB09229. | |
| Provean impurity 4 | Provean impurity 4. Uses: For analytical and research use. CAS No. 2755812-41-8. Molecular formula: C23H32F3N5O4. Mole weight: 499.54. Catalog: APB2755812418. | |
| Provean impurity 5 | Provean impurity 5. Uses: For analytical and research use. CAS No. 2628280-47-5. Molecular formula: C7H13N3O2. Mole weight: 171.2. Catalog: APB2628280475. | |
| Provean impurity 6 | Provean impurity 6. Uses: For analytical and research use. Molecular formula: C7H13N3O2. Mole weight: 171.2. Catalog: APB09230. | |
| Provean impurity 7 | Provean impurity 7. Uses: For analytical and research use. Molecular formula: C7H13N3O2. Mole weight: 171.2. Catalog: APB09232. | |
| Provean impurity 8 | Provean impurity 8. Uses: For analytical and research use. Molecular formula: C15H22N2O6S. Mole weight: 358.41. Catalog: APB09231. | |
| Provean impurity 9 | Provean impurity 9. Uses: For analytical and research use. Molecular formula: C7H12N2O3. Mole weight: 172.18. Catalog: APB09233. | |
| Provichem 0216 | Provichem 0216. |  |
| Provichem 1102 | Provichem 1102. | |
| Provigil | Provigil. CAS No: 68693-11-8 |  Sarchem Laboratories New Jersey NJ |
| Proviplast 17820 | Proviplast 17820. | |
| Proviplast 1784 | Proviplast 1784. | |
| Pro Vitamin A 10% (Beta Carotene 10%) | Pro Vitamin A 10% (Beta Carotene 10%) - Agriculture Chemicals. SUPPLIERS TO BUSINESS CUSTOMERS ONLY. |  North America & APAC |
| Pro-X dipeptidase | Transferred to EC 3.4.13.18. Group: Enzymes. Enzyme Commission Number: EC 3.4.13.8. CAS No. 9025-33-6. Storage: Store it at +4 ?C for short term. For long term storage, store it at -20 ?C?-80 ?C. Form: Liquid or lyophilized powder. EXWM-4041; Pro-X dipeptidase; EC 3.4.13.8; 9025-33-6. Cat No: EXWM-4041. | |
| Proxyfan oxalate | Proxyfan oxalate. Group: Biochemicals. Grades: Purified. CAS No. 177708-09-7. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| Pro-xylane | Hydroxypropyl tetrahydropyrantriol has been used in trials studying the basic science of Aging. Category: Cosmetic ingredients and additives. Synonyms: Hydroxypropyl tetrahydropyrantriol. Mexoryl SBB. Pro-xylane (pharmaceutical). CAS No. 439685-79-7. Product ID: CIA439685797. Molecular formula: C8H16O5. Mole weight: 192.21. SMILES: CC(CC1C(C(C(CO1)O)O)O)O. Appearance: White to off-white powder. Standard: In-house. | |
| Pro-xylane | Pro-xylane was a xylose originally derived from beech trees, but is now synthesized. Pro-xylane can enhance the binding force of the epidermis and epidermis at the dermal junction (DEJ) by adding the expression of heparan sulfate proteoglycan (HS-PGS)-basement membrane proteoglycan (Perlecan), CD44, and SYNDECANS, and further promote the synthesis of glycosaminoglycan (GAGS) and proteoglycan (PGS). It can make the skin repair firm and moist. It has the effect of anti-aging, removing wrinkles, efficient moisturizing, whitening and lightening spots, firming and repairing, anti-blue light and anti-pollution, and effectively establishing skin protective barrier. It is compatible with cream, gel and water formulations. Alternative Names: Hydroxypropyl tetrahydropyrantriol; Mexoryl SBB; (2S,3R,4S,5R)-2-(2-hydroxypropyl)tetrahydro-2H-pyran-3,4,5-triol; c-beta-d-xylopyranoside-2-hydroxypropane; RelaXin; Puri-Xylane. Grades: ≥98%. CAS No. 439685-79-7. Molecular formula: C8H16O5. Mole weight: 192.21. | |
| Proxylphylline | Proxylphylline. Group: Biochemicals. Grades: Highly Purified. CAS No. 603-00-9. Pack Sizes: 25g, 50g, 100g. US Biological Life Sciences. | Worldwide |
| Proxymetacaine hydrochloride | Proxymetacaine hydrochloride. CAS No. 5857-6-9. Product ID: ACM1445426. Alfa Chemistry - ISO 9001:32057 Certified. |  |
| PrP 106-126 (human) | Prion Protein 106-126 (human), a peptide fragment of the cellular prion protein PrP, is used as a model to investigate neurodegeneration in prion diseases. It exhibits neurotoxicity caused by amplification of PrPC-associated signaling responses and induces NF-κB-mediated apoptosis in the mouse neuroblastoma cell line N2a. Alternative Names: Prion Protein Fragment 106-126 Human; Prion Protein 106-126 (human); Lys-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Ala-Ala-Gly-Ala-Val-Val-Gly-Gly-Leu-Gly; L-lysyl-L-threonyl-L-asparagyl-L-methionyl-L-lysyl-L-histidyl-L-methionyl-L-alanyl-glycyl-L-alanyl-L-alanyl-L-alanyl-L-alanyl-glycyl-L-alanyl-L-valyl-L-valyl-glycyl-glycyl-L-leucyl-glycine. Grades: ≥95%. CAS No. 148439-49-0. Molecular formula: C80H138N26O24S2. Mole weight: 1912.24. | |
| PRRSV/CD163-IN-1 | PRRSV/CD163-IN-1 is a PRRSV/CD163 inhibitor. PRRSV/CD163-IN-1 can inhibit the interaction between the PRRSV glycoprotein (GP2a or GP4) and the CD163-SRCR5 domain. PRRSV/CD163-IN-1 can be used for the research of porcine reproductive and respiratory syndrome (PRRS) [1]. Uses: Scientific research. Category: Signaling pathways. CAS No. 560995-89-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-147089. | |
| PRT-060318 | PRT-060318 (PRT318) s a potent, selective and orally active tyrosine kinase Syk inhibitor with an IC50 of 3 nM. PRT-060318 suppresses chronic lymphocytic leukemia (CLL) B cell activation and migration, and induces apoptosis. PRT-060318 prevents Heparin (HY-17567)-induced thrombocytopenia and thrombosis in a transgenic mouse model. PRT-060318 dihydrochloride can be used for CLL and thrombus research[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: PRT318. CAS No. 1194961-19-7. Pack Sizes: 10 mM * 1 mL in Water; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-12974. | |
| PRT062607 | PRT062607 (P505-15; PRT-2607) is an orally active ATP-competitive Syk inhibitor with an IC50 value of 1 nM, and exhibits at least 80-fold selectivity over other kinases. PRT062607 blocks B cell antigen receptor-mediated activation, Fcε receptor 1-mediated basophil degranulation and microglial phagocytosis, and induces caspase-dependent apoptosis and microglial death. PRT062607 inhibits tumor growth and peripheral nerve injury-induced mechanical allodynia, and prevents neuronal loss. PRT062607 can be used in research related to rheumatoid arthritis, chronic lymphocytic leukemia, non-Hodgkin's lymphoma, neurodegenerative diseases and neuropathic pain[1][2][3][4]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: P505-15; PRT-2607; BIIB-057. CAS No. 1370261-96-3. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15322. | |
| PRT062607 | PRT062607 is a highly specific and potent inhibitor of spleen tyrosine kinase (Syk) (IC50 = 1-2 nM). Alternative Names: PRT-062607; PRT 062607; P505-15; PRT-2607; PRT 2607; PRT2607; BIIB 057; 4-((3-(2H-1,2,3-triazol-2-yl)phenyl)amino)-2-(((1R,2S)-2-aminocyclohexyl)amino)pyrimidine-5-carboxamide; 5-Pyrimidinecarboxamide, 2-[[(1R,2S)-2-aminocyclohexyl]amino]-4-[[3-(2H-1,2,3-triazol-2-yl)phenyl]amino]-; 2-[[(1R,2S)-2-Aminocyclohexyl]amino]-4-[[3-(2H-1,2,3-triazol-2-yl)phenyl]amino]-5-pyrimidinecarboxamide. Grades: >98%. CAS No. 1370261-96-3. Molecular formula: C19H23N9O. Mole weight: 393.45. | |
| PRT062607 Hydrochloride | PRT062607 (P505-15) Hydrochloride is an orally available Syk inhibitor (IC50: 1 nM) that inhibits inflammation and induction Apoptosis. PRT062607 Hydrochloride exerts potent antitumor activity in tumor xenograft mouse models[1][2]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: P505-15 Hydrochloride. CAS No. 1370261-97-4. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-15323. | |
| PRT062607 monohydrochloride | PRT062607, also known as PRT2607, P505-15, and BIIB057, is a novel, highly selective, and orally bioavailable small molecule SYK inhibitor (SYK IC(50) = 1 nM) with anti-SYK activity that is at least 80-fold greater than its affinity for other kinases. PRT062607 successfully inhibited SYK-mediated B-cell receptor signaling and decreased cell viability in NHL and CLL. Oral dosing in mice prevented BCR-mediated splenomegaly and significantly inhibited NHL tumor growth in a xenograft model. In addition, combination treatment of primary CLL cells with PRT062607 plus fludarabine produced synergistic enhancement of activity at nanomolar concentrations. PRT062607 may be a therapeutic agent for B-cell malignancies. A dose finding study in healthy volunteers has been completed. Alternative Names: 5-Pyrimidinecarboxamide, 2-[[(1R,2S)-2-aminocyclohexyl]amino]-4-[[3-(2H-1,2,3-triazol-2-yl)phenyl]amino]-, hydrochloride (1:1); PRT2607 HCl; PRT-2607 HCl; PRT 2607 HCl; RPRT062607 HCl; PRT-062607 HCl; PRT 062607 HCl; P505-15 HCl; BIIB057 HCl; BIIB 057 HCl; 2-[[(1R,2S)-2-Aminocyclohexyl]amino]-4-[[3-(2H-1,2,3-triazol-2-yl)phenyl]amino]-5-pyrimidinecarboxamide hydrochloride. Grades: 98%. CAS No. 1370261-97-4. Molecular formula: C19H23N9O.HCl. Mole weight: 429.91. | |
| PRT3789 | PRT3789 is a selective SMARCA2 PROTAC degrader (DC50 in HeLa cell: 0.72 nM for SMARCA2, 14 nM for SMARCA4). PRT3789 forms a stable ternary complex with Von Hippel-Lindau (VHL) E3 ligase, induces polyubiquitination at SMARCA2-specific lysine residues, and drives proteasome-dependent SMARCA2 degradation. PRT3789 disrupts SWI/SNF chromatin remodeling complex integrity, induces dissociation of specific subunits, suppresses oncogenic gene expression, reduces chromatin accessibility, and upregulates antigen processing/presentation-related gene expression. PRT3789 induces synthetic lethality, inhibits proliferation and colony formation, and drives tumor growth inhibition and regression in SMARCA4-deficient contexts. PRT3789 can be used for the research of SMARCA4-mutated solid tumors, non-small cell lung cancer, endometrial cancer, colorectal cancer, bladder cancer, esophageal cancer, ovarian cancer, and gastric cancer[1][2]. Uses: Scientific research. Category: Signaling pathways. CAS No. 2755761-78-3. Pack Sizes: 10 mM * 1 mL in DMSO; 1 mg; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-159607. | |
| PRT4165 | PRT4165 is a potent inhibitor of polycomb-repressive complex 1 (PRC1)-mediated H2A ubiquitylation. Uses: Scientific research. Category: Signaling pathways. Alternative Names: NSC600157. CAS No. 31083-55-3. Pack Sizes: 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-19817. | |
| PRT 4165 | PRT 4165. Group: Biochemicals. Grades: Purified. CAS No. 31083-55-3. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. | Worldwide |
| Prucalopride | Prucalopride is an orally active, selective and specific 5-HT 4 receptor agonist (high affinity), with pKis of 8.6 and 8.1 for human 5-HT4a/4b receptors, respectively. Prucalopride improves intestinal motility by promoting regeneration of the intestinal nervous system in rats. Prucalopride also shows anticancer activity by blocking of the PI3K/AKT/mTor signaling pathway. Prucalopride can be used in studies of chronic constipation, pseudo-intestinal obstruction and cancer[1][2][3]. Uses: Scientific research. Category: Signaling pathways. CAS No. 179474-81-8. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-14151. | |
| Prucalopride | Prucalopride is a potent and selective 5-HT4 receptor agonist. Prucalopride is a gastroprokinetic drug with the brand name Resolor, developed for the treatment of constipation and irritable bowel syndrome. Studies indicates that it is promisingly to be a candidate therapy of Alzheimer's disease and chronic intestinal pseudo-obstruction. Uses: Gastroprokinetic drug. Alternative Names: Resolor; 4-Amino-5-chloro-2,3-dihydro-N-[1-(3-methoxypropyl)-4-piperidinyl]-7-benzofurancarboxamide. Grades: 98%. CAS No. 179474-81-8. Molecular formula: C18H26ClN3O3. Mole weight: 367.87. | |
| Prucalopride hydrobromide | Prucalopride hydrobromide. CAS No. 179474-84-1. Purity: 96%. Product ID: ACM179474841. Molecular formula: C18H26ClN3O3.HBR. Mole weight: 36.46094;g/mol. IUPAC Name: chlorane. ECNumber: 231-595-7. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Prucalopride hydrochloride | Prucalopride hydrochloride. Alternative Names: Prucalopride hydrochloride, UNII-M8IYX9Z79V, SureCN1230671, 179474-80-7, 4-Amino-5-chloro-2,3-dihydro-N-(1-(3-methoxypropyl)-4-piperidinyl)-7-benzofurancarboxamide hydrochloride. CAS No. 179474-80-7. Purity: 96%. Product ID: ACM179474807. Molecular formula: C18H26ClN3O3.HCl. Mole weight: 404.331280 [g/mol]. IUPAC Name: 4-amino-5-chloro-N-[1-(3-methoxypropyl)piperidin-4-yl]-2,3-dihydro-1-benzofuran-7-carboxamide;hydrochloride. Alfa Chemistry - ISO 9001:32057 Certified. | |
| Prucalopride Impurity 1 | Prucalopride Impurity 1. Uses: For analytical and research use. CAS No. 2636673-48-6. Molecular formula: C18H26ClN3O4. Mole weight: 383.87. Catalog: APB2636673486. | |
| Prucalopride Impurity 18 | Prucalopride Impurity 18. CAS No. 143878-29-9. | |
| Prucalopride Impurity 2 | Prucalopride Impurity 2. Uses: For analytical and research use. Molecular formula: C18H26ClN3O4. Mole weight: 383.87. Catalog: APB12021. | |
| Prucalopride Impurity 3 | Prucalopride Impurity 3. Uses: For analytical and research use. Molecular formula: C30H46ClN3O13. Mole weight: 692.16. Catalog: APB12025. | |
| Prucalopride Impurity 4 | Prucalopride Impurity 4. Uses: For analytical and research use. CAS No. 179474-85-2. Molecular formula: C22H32ClN3O7. Mole weight: 485.96. Catalog: APB179474852. | |
| Prucalopride Impurity 4 | An impurity of Prucalopride. Prucalopride is a selective, high affinity 5-HT4 receptor agonist. It has been tested for the treatment of chronic intestinal pseudo-obstruction. Grades: > 95%. CAS No. 1599434-55-5. Molecular formula: C17H24ClN3O3. Mole weight: 353.85. | |
| Prucalopride Impurity 6 | An impurity of Prucalopride. Prucalopride is a selective, high affinity 5-HT4 receptor agonist. It has been tested for the treatment of chronic intestinal pseudo-obstruction. Alternative Names: 4-Amino-N-(1-(3-methoxypropyl)piperidin-4-yl)-2,3-dihydrobenzofuran-7-carboxamide. Grades: > 95%. CAS No. 1608459-56-8. Molecular formula: C18H27N3O3. Mole weight: 333.43. | |
| Prucalopride N-Oxide | A metabolite of Prucalopride. Prucalopride is a selective, high affinity 5-HT4 receptor agonist. It has been tested for the treatment of chronic intestinal pseudo-obstruction. Alternative Names: N-Oxo Prucalopride; 4-Amino-5-chloro-2,3-dihydro-N-[1-(3-methoxypropyl)-1-oxido-4-piperidinyl]-7-benzofurancarboxamide. Grades: > 95%. CAS No. 1900715-98-1. Molecular formula: C18H26ClN3O4. Mole weight: 383.88. | |
| Prucalopride succinate | Prucalopride succinate is an orally active, selective and specific 5-HT 4 receptor agonist (high affinity), with pKis of 8.6 and 8.1 for human 5-HT4a/4b receptors, respectively. Prucalopride succinate improves intestinal motility by promoting regeneration of the intestinal nervous system in rats. Prucalopride succinate also shows anticancer activity by blocking of the PI3K/AKT/mTor signaling pathway. Prucalopride succinate can be used in studies of chronic constipation, pseudo-intestinal obstruction and cancer[1][2][3][4]. Uses: Scientific research. Category: Signaling pathways. Alternative Names: R-108512. CAS No. 179474-85-2. Pack Sizes: 10 mM * 1 mL in DMSO; 5 mg; 10 mg; 50 mg; 100 mg; 200 mg; 500 mg; 1 g. Product ID: HY-12694. | |
Our database is helping our users find suppliers everyday.
