American Chemical Suppliers

A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.

Search for products or services, then visit the suppliers website for prices or more information.

Product
Voruciclib hydrochloride Voruciclib hydrochloride is an orally active and selective CDK inhibitor with K i values of 0.626 nM-9.1 nM. Voruciclib hydrochloride potently blocks CDK9, the transcriptional regulator of MCL-1. Voruciclib hydrochloride represses expression of MCL-1 in multiple models of diffuse large B-cell lymphoma (DLBCL) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1000023-05-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12422A. MedChemExpress MCE
Vosoritide Vosoritide is a medicine used to treat achondroplasia. Grades: ≥95%. CAS No. 1480724-61-5. Molecular formula: C176H290N56O51S3. Mole weight: 4103. BOC Sciences 9
Voxelotor Voxelotor (GBT 440) is a potent inhibitor of haemoglobin S (HbS) polymerization. Voxelotor has the potential for sickle cell disease (SCD) treatment [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: GBT 440. CAS No. 1446321-46-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-18681. MedChemExpress MCE
Voxilaprevir Voxilaprevir (GS-9857) is a noncovalent, reversible inhibitor of HCV NS3/4A protease inhibitor (PI) with pangenotypic antiviral activity [1]. Voxilaprevir inhibits genotype 1b and 3a wild-type NS3 proteases with K i values of 0.038 nM and 0.066 nM, respectively [1]. Voxilaprevir is an orally active direct-acting antiviral agent ( DAA ) and can be used for HCV infection research [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: GS-9857. CAS No. 1535212-07-7. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg. Product ID: HY-19840. MedChemExpress MCE
Voxtalisib (XL-765) Cas No. 934493-76-2. BOC Sciences 10
VP11 Reagent 10ml Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: KOH ,C4H9N3O2 , H2O. Prepack ID 90004975-10ml. See USA prepack pricing. Molekula Americas
VP 14637 Human respiratory syncytial virus (HRSV) is a major respiratory viral pathogen causing moderate to severe upper and lower respiratory tract infections in all ages and across a wide range of patient populations. Group: Biochemicals. Alternative Names: 2, 2'-[ (4-Hydroxyphenyl) methylene]bis[4-[[ (5-methyl-1H-tetrazol-1-yl) imino]methyl]phenol. Grades: Highly Purified. CAS No. 235106-62-4. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 3
Worldwide
VP-14637 VP-14637 is a small molecule inhibitor of respiratory syncytial virus (RSV) with EC50 value of 1.4 nM. It suppresses RSV via binding to the viral F protein and inhibiting the RSV fusion (EC50 = 5.4 nM). Synonyms: VP 14637; VP14637; 2-[[2-Hydroxy-5-[(E)-(5-methyltetrazol-1-yl)iminomethyl]phenyl]-(4-hydroxyphenyl)methyl]-4-[(E)-(5-methyltetrazol-1-yl)iminomethyl]phenol. Grades: ≥98%. CAS No. 235106-62-4. Molecular formula: C25H22N10O3. Mole weight: 510.5. BOC Sciences 10
VP1 Reagent 10ml Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: CH3CH2OH ,C10H8O , H2O. Prepack ID 90005085-10ml. See USA prepack pricing. Molekula Americas
VP-22 VP-22 peptide is from herpes simplex virus type-1. Synonyms: H-Asp-Ala-Ala-Thr-Ala-Thr-Arg-Gly-Arg-Ser-Ala-Ala-Ser-Arg-Pro-Thr-Glu-Arg-Pro-Arg-Ala-Pro-Ala-Arg-Ser-Ala-Ser-Arg-Pro-Arg-Arg-Pro-Val-Asp-OH; HSV-1 protein VP22. Grades: >98%. Molecular formula: C147H255N61O48. Mole weight: 3645.02. BOC Sciences 4
VPA-985 VPA-985, an azepine compound, has been found to be a Vasopressin receptor antagonist that could be used in some cardiovascular disease therapy like hyponatraemia. Uses: Drug used in the treatment and prevention of cardiovascular diseases. Synonyms: CRTX-080; CRTX080; CRTX 080; VPA-985; VPA985; VPA 985; WAY-VPA-985; Lixivaptan; N-[3-Chloro-4-(5H-pyrrolo[2,1-c][1,4]benzodiazepin-10(11H)-ylcarbonyl)phenyl]-5-fluoro-2-methylbenzamide;Lixivaptan; VPA-985. Grades: 98%. CAS No. 168079-32-1. Molecular formula: C27H21ClFN3O2. Mole weight: 473.94. BOC Sciences 8
VPC 01091 VPC 01091. Group: Others. Purity: >99%. Mole weight: 339.943. Stability: 6 Months. Storage: -20°C. Avanti Polar Lipids; lipid products; bioactive lipids; fluorescent lipids; singnal transduction; cell pathways; VPC 01091; ((1R,3S)-1-amino-3-(3-octylphenyl)cyclopentyl)methanol (hydrochloride salt). Cat No: FLBZ-104. Creative Enzymes
VPC 01211 VPC 01211. Group: Others. Purity: >99%. Mole weight: 383.462. Stability: 6 Months. Storage: -20°C. Avanti Polar Lipids; lipid products; bioactive lipids; fluorescent lipids; singnal transduction; cell pathways; VPC 01211; ((1R,3S)-1-ammonio-3-(4-octylphenyl)cyclopentyl)methyl hydrogen phosphate. Cat No: FLBZ-093. Creative Enzymes
VPC 23019 VPC 23019. Group: Biochemicals. Grades: Purified. CAS No. 449173-19-7. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 5
Worldwide
VPC 23019 VPC 23019 is an aryl amide-containing S1P analog that acts as a competitive antagonist, inhibit S1P-induced migration of thyroid cancer cells, ovarian cancer cells, and neural stem cells. Uses: Sphingosine-1-phosphate receptor antagonist. Synonyms: VPC23019; VPC-23019; (R)-phosphoric acid mono-[2-amino-2-(3-octyl-phenylcarbamoyl)-ethyl] ester. Grades: ≥98%. CAS No. 449173-19-7. Molecular formula: C17H29N2O5P. Mole weight: 372.40. BOC Sciences 9
VPC 51299 Phospholipids. Alternative Names: (R,E)-(3-palmitamido-4-(4-((4-(2,2,2-trifluoroethoxy)pyridin-2-yl)methoxy)phenyl)but-1-en-1-yl)phosphonic acid. CAS No. 1004787-61-4. Molecular formula: C34H50 F3N2O6P. Mole weight: 670.74. Appearance: Powder. Purity: >99%. Catalog: ACM1004787614. Alfa Chemistry. 3
VPC 51299 VPC 51299. Group: Others. Purity: >99%. Mole weight: 670.74. Stability: 6 Months. Storage: -20°C. Avanti Polar Lipids; lipid products; bioactive lipids; fluorescent lipids; singnal transduction; cell pathways; VPC 51299; (R,E)-(3-palmitamido-4-(4-((4-(2,2,2-trifluoroethoxy)pyriDin-2-yl)methoxy)phenyl)but-1-en-1-yl)phosphonic acid. Cat No: FLBZ-019. Creative Enzymes
VPC-70063 VPC-70063 is a Myc-Max inhibitor. VPC-70067 is a close analog of the previously identified Myc inhibitor 10058-F4. VPC-70063, of a chemically different scaffold, was the best performer in a panel of in vitro assays, and the forerunner for future hit-to-lead optimization efforts. Group: Inhibitors. Alternative Names: VPC-70063; VPC 70063; VPC70063. CAS No. 13571-44-3. Molecular formula: C16H12F6N2S. Mole weight: 378.34. Appearance: Solid powder. Purity: >98%. IUPACName: N-[3, 5-Bis (trifluoromethyl)phenyl]-N'- (phenylmethyl)thiourea. Canonical SMILES: S=C (NCC1=CC=CC=C1)NC2=CC (C (F) (F)F)=CC (C (F) (F)F)=C2. Catalog: ACM13571443. Alfa Chemistry.
vp/eicosene copolymer vp/eicosene copolymer. Group: Polymers. CAS No. 28211-18-9. Product ID: 1-ethenylpyrrolidin-2-one; icos-1-ene. Molecular formula: 391.7g/mol. Mole weight: C26H49NO. CCCCCCCCCCCCCCCCCCC=C.C=CN1CCCC1=O. InChI= 1S / C20H40. C6H9NO / c1-3-5-7-9-11-13-15-17-19-20-18-16-14 -12-10-8-6-4-2; 1-2-7-5-3-4-6 (7) 8 / h3H, 1, 4-20H2, 2H3; 2H, 1, 3-5H2. HTLWOXWXUHOLEJ-UHFFFAOYSA-N. Alfa Chemistry Materials 3
VPM peptide VPM peptide is a dithiol protease-cleavable peptide cross-linker. VPM peptide can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1428885-83-9. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3159. MedChemExpress MCE
VPS34-IN1 VPS34-IN1 is a potent and selective Vps34 inhibitor with potential anticancer activity. VPS34-IN1 inhibits Vps34 with 25 nM IC50 in vitro. Synonyms: VPS34IN1; VPS34 IN1; VPS34-IN1. Grades: 98%. CAS No. 1383716-33-3. Molecular formula: C21H24ClN7O. Mole weight: 425.91. BOC Sciences 8
VPS34 inhibitor 1 VPS34 inhibitor 1 is a potent and selective inhibitor of VPS34 (IC50 = 15 nM). Vps34 is a phosphoinositide 3-kinase (PI3K) class III isoform that has attracted major attention over the recent years because of its role in autophagy. VPS34 inhibitors can be used to investigate autophagy, a degradation process that recycles cellular components. Synonyms: 1-[[4-(cyclopropylmethyl)-5-[2-(pyridin-4-ylamino)pyrimidin-4-yl]pyrimidin-2-yl]amino]-2-methylpropan-2-ol; Compound 19, PIK-III analogue; Compound 19, PIK-III analogue. Grades: 99.27 %. CAS No. 1383716-46-8. Molecular formula: C21H25N7O. Mole weight: 391.47. BOC Sciences 10
Vps34-PIK-III Vps34-PIK-III is a potent and selective inhibitor of the type 3 phosphatidylinositol 3-kinase (PI3K) vacuolar protein sorting 34 (Vps34) (IC50 = 18 nM). Vps34-PIK-III is selective for Vps34 over related PI3K isoforms, PI4Kβ, and mTOR. Synonyms: 4-(cyclopropylmethyl)-5-[2-(pyridin-4-ylamino)pyrimidin-4-yl]pyrimidin-2-amine; PIK-III; VPS34-IN2; VPS34-IN 2; VPS34-IN-2. CAS No. 1383716-40-2. Molecular formula: C17H17N7. Mole weight: 319.36. BOC Sciences 10
VR23 VR23 is a potent and selective inhibitor of trypsin-like proteasomes (IC50 = 1 nmol/L), chymotrypsin-like proteasomes (IC50 = 50-100 nmol/L), and caspase-like proteasomes (IC50 = 3 μmol/L). Synonyms: VR23; VR-23; VR 23. Grades: 98%. CAS No. 1624602-30-7. Molecular formula: C19H16ClN5O6S. Mole weight: 477.88. BOC Sciences 10
VrCRP VrCRP is a peptide isolated from V. radiata (a bruchid-resistant mungbean). It has activity against bacteria and fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asp-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. Molecular formula: C211H347N65O63S10. Mole weight: 5123.07. BOC Sciences 4
VrD1 VrD1 is an antimicrobial plant peptide isolated from Vigna radiata. It has activity against fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asn-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. BOC Sciences 4
VrD2 VrD2 is an plant antimicrobial peptide isolated from Vigna radiata. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asn-Thr-Tyr-Arg-Gly-Pro-Cys-Phe-Thr-Thr-Gly-Ser-Cys-Asp-Asp-His-Cys-Lys-Asn-Lys-Glu-His-Leu-Arg-Ser-Gly-Arg-Cys-Arg-Asp-Asp-Phe-Arg-Cys-Trp-Cys-Thr-Arg-Asn-Cys. Molecular formula: C222H347N77O72S8. Mole weight: 5503.15. BOC Sciences 4
VRT-043198 VRT-043198, the active metabolite of VX-765, is a Caspase inhibitor. VRT-043198 exhibits 100- to 10,000-fold selectivity against other caspase-3 and -6 to -9. VRT-043198 inhibited the release of interleukin (IL)-1beta and IL-18, but it had little effect on the release of several other cytokines, including IL-1alpha, tumor necrosis factor-alpha, IL-6 and IL-8. Synonyms: VRT043198; VRT 043198; N-(4-Amino-3-chlorobenzoyl)-3-methyl-L-valyl-N-[(1S)-2-carboxy-1-formylethyl]-L-prolinamide; (S)-3-({1-((S)-1-((S)-2-{(1-(4-Amino-3-chlorophenyl)methanoyl)amino}-3,3-dimethyl-butanoyl)pyrrolidin-2-yl)methanoyl}amino)-4-oxobutyric acid. Grades: ≥98%. CAS No. 244133-31-1. Molecular formula: C22H29ClN4O6. Mole weight: 480.94. BOC Sciences 11
VRX-806 VRX-806 is a novel nonnucleoside reverse transcriptase inhibitor (NNRTI) with potent in vitro activity against wild-type and NNRTI-resistant HIV-1. Synonyms: VRX-806; VRX 806; VRX806; AR-806; AR 806; AR806; RDEA-806; RDEA 806; RDEA806;4-[[2-[[5-bromo-4-(4-cyclopropylnaphthalen-1-yl)-1,2,4-triazol-3-yl]sulfanyl]acetyl]amino]-3-chlorobenzoic acid. Grades: >98 %. CAS No. 1004523-72-1. Molecular formula: C24H18BrClN4O3S. Mole weight: 557.85. BOC Sciences 9
VS-5584 VS-5584 is a pan-PI3K/mTOR kinase inhibitor with IC50s of 16 nM, 68 nM, 42 nM, 25 nM, and 37 nM for PI3Kα, PI3Kβ, PI3Kδ, PI3Kγ and mTOR, respectively. VS-5584 simultaneously blocks mTORC2 as well as mTORC1. Synonyms: VS5584; VS 5584; VS5584; SB2343; SB2343; SB 2343. CAS No. 1246560-33-7. Molecular formula: C17H22N8O. Mole weight: 354.418. BOC Sciences 10
VSe2 Crystal Graphene-like Materials Series. CAS No. 12299-51-3. Purity: 0.99995. Catalog: ACM12299513. Alfa Chemistry. 5
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Exendin-4 is a pure GLP-1 receptor agonist. Mole weight: 3241.7. BOC Sciences 3
Vsp I One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 10-fold overdigestion with enzyme 70% of the dna fragments can be ligated.of these, 90% can be recut. in the presence of 10% peg ligation is better. Group: Restriction Enzymes. Purity: 1000U; 5000U. AT↑TAAT TAAT↓TA. Activity: 10000u.a./ml. Appearance: 10 X SE-buffer W. Storage: -20°C. Form: Liquid. Source: An E.coli strain, that carries the cloned gene VspI from Vibrio species 343. Pack: 10 mM Tris-HCl (pH 7.6); 50 mM NaCl; 0.1 mM EDTA; 1 mM DTT; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1187RE. Creative Enzymes
VSPPLTLGQLLS VSPPLTLGQLLS is a small peptide FGFR3 inhibitor, peptide P3, inhibits FGFR3 phosphorylation. VSPPLTLGQLLS inhibits 9-cisRA-induced tracheal lymphangiogenesis and blocks lymphatic endothelial cell (LEC) proliferation, migration, and tubule formation [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1206896-24-3. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3695. MedChemExpress MCE
VSV-G Peptide VSV-G Peptide, vesicular stomatitis virus G (VSV-G) protein fragment, is commonly engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be analyzed and visualized using immunochemical methods. Synonyms: H-Tyr-xiThr-Asp-xiIle-Glu-Met-Asn-Arg-Leu-Gly-Lys-OH; L-tyrosyl-(3xi)-L-threonyl-L-alpha-aspartyl-(3xi)-L-isoleucyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-arginyl-L-leucyl-glycyl-L-lysine. Molecular formula: C57H94N16O19S. Mole weight: 1339.52. BOC Sciences 3
VT-1161 VT-1161 is a 14-alpha demethylase inhibitor as a tetrazole antifungal agent originated by Viamet Pharmaceuticals. VT-1161 shows potent efficacy in treatment of dermatophytosis in a guinea pig model. Phase II clinical trials for the treatment of Onychomycosis and Vulvovaginal candidiasis is on-going. Uses: Onychomycosis; vulvovaginal candidiasis. Synonyms: VT 1161; VT1161; Oteseconazole. Grades: 98%. CAS No. 1340593-59-0. Molecular formula: C23H16F7N5O2. Mole weight: 527.40. BOC Sciences 9
VT-1598 VT-1598 is an orally active and selective fungal inhibitor targeting CYP51. VT-1598 shows anti-fungal activity against Candida auris [1] [2]. VT-1598 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 2089320-99-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-123777. MedChemExpress MCE
VT-464 VT-464, also called as Seviteronel, is an oral, non-steroidal, lyase-selective CYP17 inhibitor to reach Phase II clinical trials in Breast cancer in USA (PO). in vitro: Approximately 10-fold more selective towards lyase than hydroxylase. Selective inhibit. Uses: Antineoplastic agents. Synonyms: (1S)-1-[6,7-bis(difluoromethoxy)naphthalen-2-yl]-2-methyl-1-(2H-triazol-4-yl)propan-1-ol; VT464; VT 464; VT-464; INO-464; INO 464; INO464;CHEMBL3264610; CS-3139; CS 3139; CS3139; HY-15996; UNII-8S5OIN36X4 component ZBRAJOQFSNYJMF-SFHVURJKSA-N; 1610537-15-9; 1H-1,2,3-Triazole-5-methanol, alpha-(6,7-bis(difluoromethoxy). CAS No. 1610537-15-9. Molecular formula: C18H17F4N3O3. Mole weight: 399.34. BOC Sciences 11
VT-464 racemate The racemate form of VT-464, a non-steroidal compound, has been found to lead to the reduction of androgen through acting as a human CYP17 lyase inhibitor. IC50: 69 nM. Uses: The racemate form of vt-464 has been found to lead to the reduction of androgen through acting as a human cyp17 lyase inhibitor. Synonyms: VT-464 racemate; VT 464 racemate; VT464 racemate; VT-464; CHEMBL3264610; CS-3139; CS 3139; CS3139; UNII-8S5OIN36X4 component ZBRAJOQFSNYJMF-SFHVURJKSA-N. Grades: 98%. CAS No. 1375603-36-3. Molecular formula: C18H17F4N3O3. Mole weight: 399.34. BOC Sciences 11
VT-464 R enantiomer The R-enantiomer form of VT-464, a non-steroidal compound, has been found to lead to the reduction of androgen through acting as a human CYP17 lyase inhibitor. Uses: The r-enantiomer form of vt-464 has been found to lead to the reduction of androgen through acting as a human cyp17 lyase inhibitor. Synonyms: VT-464 (R enantiomer); VT 464 R enantiomer; VT464 R enantiomer; CS-3140; CS 3140; CS3140; UNII-8S5OIN36X4 component ZBRAJOQFSNYJMF-GOSISDBHSA-N. Grades: 98%. CAS No. 1375603-38-5. Molecular formula: C18H17F4N3O3. Mole weight: 399.34. BOC Sciences 11
VT-ME6 VT-ME6 is a selective sphingosine kinase 2 inhibitor. VT-ME6 shows three-fold selectivity for SphK2 over SphK1. It has a quaternary ammonium group which is necessary for engaging key amino acid residues in the enzyme binding pocket.13,14. Synonyms: VT-ME6, VT-ME-6, VT-ME 6; Dimethyl-[4-(4-octyl-phenyl)-cyclohexyl]-propyl-ammonium iodide. Grades: 98%. CAS No. 1353880-00-8. Molecular formula: C25H44IN. Mole weight: 484.54. BOC Sciences 9
VTP-27999 VTP-27999 is an alkyl amine Renin inhibitor. It is useful for Hypertension and End-Organ Diseases. Synonyms: VTP-27999; VTP 27999; VTP27999. Grades: >98%. CAS No. 942142-51-0. Molecular formula: C26H41ClN4O5. Mole weight: 525.08. BOC Sciences 9
VTP-27999 2,2,2-trifluoroacetate VTP-27999 2,2,2-trifluoroacetate is an alkyl amine Renin inhibitor, useful for Hypertension and End-Organ Diseases. Synonyms: VTP-27999; VTP27999; VTP 27999. VTP-27999 HCl; VTP-27999 TFA. Grades: >98%. CAS No. 1013937-63-7. Molecular formula: C28H42ClF3N4O7. Mole weight: 639.1. BOC Sciences 9
VTP-27999 Hydrochloride VTP-27999 Hcl is an alkyl amine Renin inhibitor; VTP-27999 is useful for Hypertension and End-Organ Diseases. Uses: Scientific research. Group: Signaling pathways. CAS No. 1264191-73-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-76652. MedChemExpress MCE
VTP-27999 Hydrochloride VTP-27999 Hcl is an alkyl amine Renin inhibitor; VTP-27999 is useful for Hypertension and End-Organ Diseases. Synonyms: VTP27999 Hydrochloride; VTP 27999 Hydrochloride. Grades: >98%. CAS No. 1264191-73-2. Molecular formula: C26H42Cl2N4O5. Mole weight: 561.54. BOC Sciences 9
VTP-27999 TFA VTP-27999 TFA is an alkyl amine Renin inhibitor; VTP-27999 TFA is useful for Hypertension and End-Organ Diseases. Uses: Scientific research. Group: Signaling pathways. CAS No. 1013937-63-7. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-50769. MedChemExpress MCE
VTP-37948 VTP-37948, also called BI 1181181, being clinically developed with Boehringer Ingelheim and Vitae Pharmaceuticals, is an inhibitor targeted to the catalytic site of the enzymes BACE1 and BACE2 designed for treating Alzheimer's disease. Synonyms: BI 1181181; BI-1181181; VTP-37948; BI1181181; VTP37948; VTP 37948. BOC Sciences 10
VTP50469 VTP50469 is a Menin-MLL interaction inhibitor, effective against MLL rearrangement and NPM1c+ leukemia. It has effective anti-leukemia activity. Grades: ≥98% by HPLC. CAS No. 2169916-18-9. Molecular formula: C32H47FN6O4S. Mole weight: 630.82. BOC Sciences 9
VTP50469 VTP50469 Inhibitor. Uses: Scientific use. Product Category: T13336. CAS No. 2169916-18-9. TARGETMOL CHEMICALS
v-Triazolo[4,5-b]pyridine,5,7-dimethyl-(6ci) Heterocyclic Organic Compound. Alternative Names: v-Triazolo[4,5-b]pyridine, 5,7-dimethyl- (6CI);5,7-Dimethyl-v-triazolo[4,5-b]pyridine. CAS No. 114163-51-8. Molecular formula: C7H8N4. Mole weight: 148.168. Purity: 0.96. IUPACName: 5,7-dimethyl-2H-triazolo[4,5-b]pyridine. Canonical SMILES: CC1=CC(=NC2=NNN=C12)C. Catalog: ACM114163518. Alfa Chemistry.
v-Triazolo[4,5-d]pyrimidine,5-methylamino-(6ci) Heterocyclic Organic Compound. Alternative Names: v-Triazolo[4,5-d]pyrimidine, 5-methylamino- (6CI). CAS No. 117890-88-7. Molecular formula: C5H6N6. Catalog: ACM117890887. Alfa Chemistry. 2
VTX-27 Selective PKC inhibitor. VTX-27 is a potent and selective inhibitor of the PKCth enzyme, with over 1000-fold against classical isoforms and over 10,000-fold against atypical isoforms. Group: Biochemicals. Grades: Highly Purified. CAS No. 1321924-70-2. Pack Sizes: 1mg, 5mg. Molecular Formula: C20H24ClFN6O, Form: Supplied as a. US Biological Life Sciences. USBiological 4
Worldwide
VU0029251 VU002925 1is a partial antagonist of metabotropic glutamate receptor 5 (mGluR5) with Ki value of 1.07 μM. Synonyms: 10-methylsulfanyl-7-thia-9,11-diazatricyclo[6.4.0.02,6]dodeca-1(12),2(6),8,10-tetraen-12-amine. CAS No. 330819-85-7. Molecular formula: C10H11N3S2. Mole weight: 237.3. BOC Sciences 10
VU 0029767 VU 0029767 is a positive allosteric modulator of M1, a member of the muscarinic acetylcholine family of GPCRs (mAChRs). VU 0029767 enhances the competitive effect of ACh for M1. VU0029767 potentiates ACh-mediated intracellular calcium mobilization, but not phospholipase D activation. Synonyms: VU0029767, VU 0029767, VU-0029767; 2-(4-ethoxyanilino)-N'-[(Z)-(2-oxonaphthalen-1-ylidene)methyl]acetohydrazide. Grades: 98%. CAS No. 326001-01-8. Molecular formula: C21H21N3O3. Mole weight: 363.41. BOC Sciences 10
VU0071063 VU0071063 is a potent and selective Kir6.2/SUR1 potassium channel activator. It inhibits glucose-stimulated calcium entry in isolated mouse pancreatic β-cells. Synonyms: 7-[(4-tert-butylphenyl)methyl]-1,3-dimethyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione. Grades: ≥98%. CAS No. 333415-38-6. Molecular formula: C18H22N4O2. Mole weight: 326.4. BOC Sciences 10
VU0119498 VU0119498 is an M1 muscarinic receptor agonist (EC50 = 3.1 μM) and pan-mAChR M3, M5 positive allosteric modulator (PAM), and a neuroprotective agent. It has anti-diabetic activity. Synonyms: 1-[(4-Bromophenyl)Methyl]Indole-2,3-Dione; N-4-Bromobenzylisatin; 1-(4-Bromobenzyl)-1H-Indole-2,3-Dione. Grades: 98%. CAS No. 79183-37-2. Molecular formula: C15H10BrNO2. Mole weight: 316.15. BOC Sciences 10
VU 0134992 VU 0134992 is a Kir4.1 potassium channel blocker with IC50 value of 0.97 μM. Synonyms: 2-(2-Bromo-4-isopropylphenoxy)-N-(2,2,6,6-tetramethylpiperidin-4-yl)acetamide. Grades: ≥98% by HPLC. CAS No. 755002-90-5. Molecular formula: C20H31BrN2O2. Mole weight: 411.38. BOC Sciences 10
VU0134992 hydrochloride VU0134992 hydrochloride is the first subtype-preferring, orally active and selective Kir4.1 potassium channel pore blocker, with an IC 50 of 0.97 μM. VU0134992 hydrochloride is 9-fold selective for homomeric Kir4.1 over Kir4.1/5.1 concatemeric channels (IC 50 =9 μM) at -120 mV [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1052515-91-9. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-122560A. MedChemExpress MCE
VU0152099 VU0152099 is a potent and selective allosteric potentiator of M4 mAChR with an EC50 of 380 ± 93 nM. VU0152099 has no agonist activity but potentiated responses of M4 to acetylcholine. Synonyms: VU 0152099; VU-0152099. Grades: 98%. CAS No. 612514-42-8. Molecular formula: C18H17N3O3S. Mole weight: 355.41. BOC Sciences 8
VU0152100 VU0152100 is a selective and positive allosteric modulators of M4 receptor. It has shown a potent positive allosteric modulators that increase the response of the M4 receptor to the endogenous agonist ACh in in vitro study. And it has been revealed to enhance receptor activation by increasing the affinity of M4 for acetylcholine. Synonyms: VU0152100, VU-0152100, VU 0152100, VU152100, VU 152100, VU-152100. Grades: >98%. CAS No. 409351-28-6. Molecular formula: C18H19N3O2S. Mole weight: 341.43. BOC Sciences 10
VU 0155041 VU 0155041. Group: Biochemicals. Grades: Purified. CAS No. 1093757-42-6. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
VU 0155041 VU 0155041 is a potent positive allosteric modulator at mGlu4 receptors (EC50 = 798 and 693 nM at human and rat mGlu4 receptors, respectively). VU 0155041 displays no activity for 67 G protein-coupled receptors, ion channels, and transporters, and lacks antagonist activity at NMDA receptors in striatal medium spiny neurons at a concentration of 10 μM. VU 0155041 is active in in vivo models of Parkinson's disease following i.c.v. administration. Synonyms: VU0155041, VU 0155041, VU-0155041; cis-2-[[ (3, 5-Dichlorophenyl) amino]carbonyl]cyclohexanecarboxylic acid; (1R,2S)-2-[(3,5-dichlorophenyl)carbamoyl]cyclohexane-1-carboxylic acid. Grades: ≥99% by HPLC. CAS No. 1093757-42-6. Molecular formula: C14H15Cl2NO3. Mole weight: 316.18. BOC Sciences 10
VU 0155041 sodium salt VU 0155041 sodium salt is a potent positive allosteric modulator at mGlu4 receptors (EC50 = 798 and 693 nM at human and rat mGlu4 receptors, respectively). VU 0155041 displays no activity for 67 G protein-coupled receptors, ion channels, and transporters, and lacks antagonist activity at NMDA receptors in striatal medium spiny neurons at a concentration of 10 μM. VU 0155041 is active in in vivo models of Parkinson's disease following i.c.v. administration. Synonyms: VU 0155041 sodium salt; VU0155041 sodium salt; VU-0155041 sodium salt; cis-2-[[ (3, 5-Dichlorophenyl) amino]carbonyl]cyclohexanecarboxylic acid sodium salt. Grades: ≥98% by HPLC. CAS No. 1259372-69-4. Molecular formula: C14H14Cl2NNaO3. Mole weight: 338.16. BOC Sciences 10
VU 0155041 sodium salt VU 0155041 sodium salt. Group: Biochemicals. Grades: Purified. CAS No. 1259372-69-4. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
VU0155041, Sodium Salt (cis-2- (3, 5-Dichlorophenyl carbamoyl ) cyclohexane carboxyl ic Acid Sodium Salt) A highly potent, selective positive allosteric modulator for mGlu receptor subtype 4 (EC50 = 0.8 and 0.7uM at human and rat mGlu4 receptors respectively). Does not interact with other mGluR subtypes. Significant antiparkinsonian effects in two preclinical rodent models of Parkinson's disease when administered intracerebroventri cularlly (icv). Group: Biochemicals. Grades: Highly Purified. Pack Sizes: 10mg. US Biological Life Sciences. USBiological 4
Worldwide
Vu0155069 Heterocyclic Organic Compound. CAS No. 1130067-06-9. Molecular formula: C26H27ClN4O2. Mole weight: C26H27CIN4O2.HCl. Purity: >98 %. Catalog: ACM1130067069. Alfa Chemistry.
VU 0155069 VU 0155069. Group: Biochemicals. Grades: Purified. CAS No. 1130067-06-9. Pack Sizes: 10mg, 50mg. US Biological Life Sciences. USBiological 5
Worldwide
VU 0155069 VU 0155069 is a potent and selective phospholipase D1 (PLD1) inhibitor (IC50 = 46 and 933 nM for PLD1 and PLD2, respectively). VU 0155069 has been shown to inhibit migration of human and mouse breast cancer cell lines in transwell assays. Synonyms: VU-0155069; VU 0155069; VU0155069; N-[(1S)-2-[4-(5-Chloro-2,3-dihydro-2-oxo-1H-benzimidazol-1-yl)-1-piperidinyl]-1-methylethyl-2-naphthalenecarboxamide. Grades: ≥98% by HPLC. CAS No. 1130067-06-9. Molecular formula: C26H27ClN4O2. Mole weight: 462.98. BOC Sciences 10
Vu 0238429 Heterocyclic Organic Compound. Alternative Names: 1-[ (4-methoxyphenyl)methyl]-5- (trifluoromethoxy)indole-2, 3-dione. CAS No. 1160247-92-6. Molecular formula: C17H12F3NO4. Mole weight: 351.28. Purity: 0.96. IUPACName: 1-[ (4-methoxyphenyl)methyl]-5- (trifluoromethoxy)indole-2, 3-dione. Canonical SMILES: COC1=CC=C (C=C1)CN2C3=C (C=C (C=C3)OC (F) (F)F)C (=O)C2=O. Catalog: ACM1160247926. Alfa Chemistry. 2
VU 0238429 VU 0238429 is a selective positive allosteric modulator of M5 muscarinic acetylcholine receptor (EC50 = 1.16, >30 and >30 μM at M5, M1 and M3 receptors, respectively) with no activity at M2 and M4 receptors. Synonyms: VU0238429, VU 0238429, VU-0238429; 1-(4-Methoxybenzyl)-5-trifluoromethoxyisatin; 1-[(4-methoxyphenyl)methyl]-5-(trifluoromethoxy)indole-2,3-dione. Grades: ≥99% by HPLC. CAS No. 1160247-92-6. Molecular formula: C17H12F3NO4. Mole weight: 351.28. BOC Sciences 10

Would you like to list your products on USA Chemical Suppliers?

Our database is helping our users find suppliers everyday.

Add Your Products