A directory of where to buy chemicals in the USA, including: distributors, industrial manufacturers, bulk supplies and wholesalers of raw ingredients & finished goods.
Vortioxetine Impurity 67. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C14H15NOS. Mole Weight: 245.34. Catalog: APB10124.
Vortioxetine Impurity 68
Vortioxetine Impurity 68. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C28H26N2S2. Mole Weight: 454.65. Catalog: APB10126.
Vortioxetine Impurity 69
Vortioxetine Impurity 69. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C28H28N2S2. Mole Weight: 456.67. Catalog: APB10125.
Vortioxetine Impurity 7
Vortioxetine Impurity 7. Uses: For analytical and research use. Group: Impurity standards. CAS No. 508233-75-8. Molecular Formula: C18H22N2S. Mole Weight: 298.45. Catalog: APB508233758.
Vortioxetine Impurity 7
One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Molecular formula: C18H22N2S. Mole weight: 298.45.
Vortioxetine Impurity 70
Vortioxetine Impurity 70. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C28H26N2OS2. Mole Weight: 470.65. Catalog: APB10128.
Vortioxetine Impurity 71
Vortioxetine Impurity 71. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C22H31Cl2N3S. Mole Weight: 440.47. Catalog: APB10127.
Vortioxetine Impurity 72
Vortioxetine Impurity 72. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C15H17NS. Mole Weight: 243.37. Catalog: APB10129.
Vortioxetine Impurity 73
Vortioxetine Impurity 73. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C20H25ClN2S. Mole Weight: 360.94. Catalog: APB10131.
Vortioxetine Impurity 74
Vortioxetine Impurity 74. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C18H22N2OS. Mole Weight: 314.45. Catalog: APB10130.
Vortioxetine Impurity 75
Vortioxetine Impurity 75. Uses: For analytical and research use. Group: Impurity standards. Molecular Formula: C18H22Br2N2S. Mole Weight: 458.26. Catalog: APB10132.
Vortioxetine Impurity 8
Vortioxetine Impurity 8. Uses: For analytical and research use. Group: Impurity standards. CAS No. 2135576-73-5. Molecular Formula: C19H22N2OS. Mole Weight: 326.46. Catalog: APB2135576735.
Vortioxetine Impurity 8
One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Synonyms: 4-Desmethyl 5-Methyl Vortioxetine; 1-[2-[(2,5-dimethylphenyl)thio]phenyl]-piperazine. Molecular formula: C18H22N2S. Mole weight: 298.45.
Vortioxetine Impurity 9
Vortioxetine Impurity 9. Uses: For analytical and research use. Group: Impurity standards. CAS No. 508233-77-0. Molecular Formula: C18H22N2S. Mole Weight: 298.45. Catalog: APB508233770.
Vortioxetine Impurity 9 HCl
One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Synonyms: 5-Chloro-Vortioxetine Hydrochloride. Molecular formula: C18H21ClN2S. HCl. Mole weight: 369.36.
Vortioxetine Lactose Adduct
Vortioxetine Lactose Adduct. Uses: For analytical and research use. Group: Impurity standards. Catalog: APS003497. Format: Neat.
Vortioxetine Sulfoxide
One of the impurities of Vortioxetine which is a 5-HT receptor inhibitor as well s an Serotonin transporter, has been found to be an atypical antidepressant. Synonyms: 1-[2-[(2,4-Dimethylphenyl)sulfinyl]phenyl]-piperazine. Molecular formula: C18H22N2OS. Mole weight: 314.45.
Voruciclib
Voruciclib is an orally active and selective CDK inhibitor with K i values of 0.626 nM-9.1 nM. Voruciclib potently blocks CDK9, the transcriptional regulator of MCL-1. Voruciclib represses expression of MCL-1 in multiple models of diffuse large B-cell lymphoma (DLBCL) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1000023-04-0. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg; 50 mg. Product ID: HY-12422.
Voruciclib
Voruciclib is a flavone and cyclin dependent kinase (CDK) inhibitor with potential antineoplastic activity. Synonyms: Voruciclib; UNII-W66XP666AM; P1446A05, P1446A-05, P1446A 05. CAS No. 1000023-04-0. Molecular formula: C22H19ClF3NO5. Mole weight: 469.83.
Voruciclib hydrochloride
Voruciclib hydrochloride is an orally active and selective CDK inhibitor with K i values of 0.626 nM-9.1 nM. Voruciclib hydrochloride potently blocks CDK9, the transcriptional regulator of MCL-1. Voruciclib hydrochloride represses expression of MCL-1 in multiple models of diffuse large B-cell lymphoma (DLBCL) [1]. Uses: Scientific research. Group: Signaling pathways. CAS No. 1000023-05-1. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-12422A.
Vosoritide
Vosoritide is a medicine used to treat achondroplasia. Grades: ≥95%. CAS No. 1480724-61-5. Molecular formula: C176H290N56O51S3. Mole weight: 4103.
Voxelotor
Voxelotor (GBT 440) is a potent inhibitor of haemoglobin S (HbS) polymerization. Voxelotor has the potential for sickle cell disease (SCD) treatment [1]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: GBT 440. CAS No. 1446321-46-5. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg; 200 mg; 500 mg. Product ID: HY-18681.
Voxilaprevir
Voxilaprevir (GS-9857) is a noncovalent, reversible inhibitor of HCV NS3/4A protease inhibitor (PI) with pangenotypic antiviral activity [1]. Voxilaprevir inhibits genotype 1b and 3a wild-type NS3 proteases with K i values of 0.038 nM and 0.066 nM, respectively [1]. Voxilaprevir is an orally active direct-acting antiviral agent ( DAA ) and can be used for HCV infection research [2]. Uses: Scientific research. Group: Signaling pathways. Alternative Names: GS-9857. CAS No. 1535212-07-7. Pack Sizes: 10 mM * 1 mL; 1 mg; 5 mg; 10 mg. Product ID: HY-19840.
Voxtalisib (XL-765)
Cas No. 934493-76-2.
VP11 Reagent
10ml Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: KOH ,C4H9N3O2 , H2O. Prepack ID 90004975-10ml. See USA prepack pricing.
VP 14637
Human respiratory syncytial virus (HRSV) is a major respiratory viral pathogen causing moderate to severe upper and lower respiratory tract infections in all ages and across a wide range of patient populations. Group: Biochemicals. Alternative Names: 2, 2'-[ (4-Hydroxyphenyl) methylene]bis[4-[[ (5-methyl-1H-tetrazol-1-yl) imino]methyl]phenol. Grades: Highly Purified. CAS No. 235106-62-4. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
VP-14637
VP-14637 is a small molecule inhibitor of respiratory syncytial virus (RSV) with EC50 value of 1.4 nM. It suppresses RSV via binding to the viral F protein and inhibiting the RSV fusion (EC50 = 5.4 nM). Synonyms: VP 14637; VP14637; 2-[[2-Hydroxy-5-[(E)-(5-methyltetrazol-1-yl)iminomethyl]phenyl]-(4-hydroxyphenyl)methyl]-4-[(E)-(5-methyltetrazol-1-yl)iminomethyl]phenol. Grades: ≥98%. CAS No. 235106-62-4. Molecular formula: C25H22N10O3. Mole weight: 510.5.
VP1 Reagent
10ml Pack Size. Group: Analytical Reagents, Biochemicals, Diagnostic Raw Materials. Formula: CH3CH2OH ,C10H8O , H2O. Prepack ID 90005085-10ml. See USA prepack pricing.
VP-22
VP-22 peptide is from herpes simplex virus type-1. Synonyms: H-Asp-Ala-Ala-Thr-Ala-Thr-Arg-Gly-Arg-Ser-Ala-Ala-Ser-Arg-Pro-Thr-Glu-Arg-Pro-Arg-Ala-Pro-Ala-Arg-Ser-Ala-Ser-Arg-Pro-Arg-Arg-Pro-Val-Asp-OH; HSV-1 protein VP22. Grades: >98%. Molecular formula: C147H255N61O48. Mole weight: 3645.02.
VPA-985
VPA-985, an azepine compound, has been found to be a Vasopressin receptor antagonist that could be used in some cardiovascular disease therapy like hyponatraemia. Uses: Drug used in the treatment and prevention of cardiovascular diseases. Synonyms: CRTX-080; CRTX080; CRTX 080; VPA-985; VPA985; VPA 985; WAY-VPA-985; Lixivaptan; N-[3-Chloro-4-(5H-pyrrolo[2,1-c][1,4]benzodiazepin-10(11H)-ylcarbonyl)phenyl]-5-fluoro-2-methylbenzamide;Lixivaptan; VPA-985. Grades: 98%. CAS No. 168079-32-1. Molecular formula: C27H21ClFN3O2. Mole weight: 473.94.
VPC 23019. Group: Biochemicals. Grades: Purified. CAS No. 449173-19-7. Pack Sizes: 10mg. US Biological Life Sciences.
Worldwide
VPC 23019
VPC 23019 is an aryl amide-containing S1P analog that acts as a competitive antagonist, inhibit S1P-induced migration of thyroid cancer cells, ovarian cancer cells, and neural stem cells. Uses: Sphingosine-1-phosphate receptor antagonist. Synonyms: VPC23019; VPC-23019; (R)-phosphoric acid mono-[2-amino-2-(3-octyl-phenylcarbamoyl)-ethyl] ester. Grades: ≥98%. CAS No. 449173-19-7. Molecular formula: C17H29N2O5P. Mole weight: 372.40.
VPC-70063 is a Myc-Max inhibitor. VPC-70067 is a close analog of the previously identified Myc inhibitor 10058-F4. VPC-70063, of a chemically different scaffold, was the best performer in a panel of in vitro assays, and the forerunner for future hit-to-lead optimization efforts. Uses: Designed for use in research and industrial production. Additional or Alternative Names: VPC-70063; VPC 70063; VPC70063. Product Category: Inhibitors. Appearance: Solid powder. CAS No. 13571-44-3. Molecular formula: C16H12F6N2S. Mole weight: 378.34. Purity: >98%. IUPACName: N-[3,5-Bis(trifluoromethyl)phenyl]-N'-(phenylmethyl)thiourea. Canonical SMILES: S=C(NCC1=CC=CC=C1)NC2=CC(C(F)(F)F)=CC(C(F)(F)F)=C2. Product ID: ACM13571443. Alfa Chemistry ISO 9001:2015 Certified.
VPM peptide is a dithiol protease-cleavable peptide cross-linker. VPM peptide can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1428885-83-9. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3159.
VPS34-IN1
VPS34-IN1 is a potent and selective Vps34 inhibitor with potential anticancer activity. VPS34-IN1 inhibits Vps34 with 25 nM IC50 in vitro. Synonyms: VPS34IN1; VPS34 IN1; VPS34-IN1. Grades: 98%. CAS No. 1383716-33-3. Molecular formula: C21H24ClN7O. Mole weight: 425.91.
VPS34 inhibitor 1
VPS34 inhibitor 1 is a potent and selective inhibitor of VPS34 (IC50 = 15 nM). Vps34 is a phosphoinositide 3-kinase (PI3K) class III isoform that has attracted major attention over the recent years because of its role in autophagy. VPS34 inhibitors can be used to investigate autophagy, a degradation process that recycles cellular components. Synonyms: 1-[[4-(cyclopropylmethyl)-5-[2-(pyridin-4-ylamino)pyrimidin-4-yl]pyrimidin-2-yl]amino]-2-methylpropan-2-ol; Compound 19, PIK-III analogue; Compound 19, PIK-III analogue. Grades: 99.27 %. CAS No. 1383716-46-8. Molecular formula: C21H25N7O. Mole weight: 391.47.
Vps34-PIK-III
Vps34-PIK-III is a potent and selective inhibitor of the type 3 phosphatidylinositol 3-kinase (PI3K) vacuolar protein sorting 34 (Vps34) (IC50 = 18 nM). Vps34-PIK-III is selective for Vps34 over related PI3K isoforms, PI4Kβ, and mTOR. Synonyms: 4-(cyclopropylmethyl)-5-[2-(pyridin-4-ylamino)pyrimidin-4-yl]pyrimidin-2-amine; PIK-III; VPS34-IN2; VPS34-IN 2; VPS34-IN-2. CAS No. 1383716-40-2. Molecular formula: C17H17N7. Mole weight: 319.36.
VR23
VR23 is a potent and selective inhibitor of trypsin-like proteasomes (IC50 = 1 nmol/L), chymotrypsin-like proteasomes (IC50 = 50-100 nmol/L), and caspase-like proteasomes (IC50 = 3 μmol/L). Synonyms: VR23; VR-23; VR 23. Grades: 98%. CAS No. 1624602-30-7. Molecular formula: C19H16ClN5O6S. Mole weight: 477.88.
VrCRP
VrCRP is a peptide isolated from V. radiata (a bruchid-resistant mungbean). It has activity against bacteria and fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asp-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys. Molecular formula: C211H347N65O63S10. Mole weight: 5123.07.
VrD1
VrD1 is an antimicrobial plant peptide isolated from Vigna radiata. It has activity against fungi. Synonyms: Arg-Thr-Cys-Met-Ile-Lys-Lys-Glu-Gly-Trp-Gly-Lys-Cys-Leu-Ile-Asp-Thr-Thr-Cys-Ala-His-Ser-Cys-Lys-Asn-Arg-Gly-Tyr-Ile-Gly-Gly-Asn-Cys-Lys-Gly-Met-Thr-Arg-Thr-Cys-Tyr-Cys-Leu-Val-Asn-Cys.
VrD2
VrD2 is an plant antimicrobial peptide isolated from Vigna radiata. It has activity against gram-positive bacteria, gram-negative bacteria and fungi. Synonyms: Lys-Thr-Cys-Glu-Asn-Leu-Ala-Asn-Thr-Tyr-Arg-Gly-Pro-Cys-Phe-Thr-Thr-Gly-Ser-Cys-Asp-Asp-His-Cys-Lys-Asn-Lys-Glu-His-Leu-Arg-Ser-Gly-Arg-Cys-Arg-Asp-Asp-Phe-Arg-Cys-Trp-Cys-Thr-Arg-Asn-Cys. Molecular formula: C222H347N77O72S8. Mole weight: 5503.15.
VRT-043198
VRT-043198, the active metabolite of VX-765, is a Caspase inhibitor. VRT-043198 exhibits 100- to 10,000-fold selectivity against other caspase-3 and -6 to -9. VRT-043198 inhibited the release of interleukin (IL)-1beta and IL-18, but it had little effect on the release of several other cytokines, including IL-1alpha, tumor necrosis factor-alpha, IL-6 and IL-8. Synonyms: VRT043198; VRT 043198; N-(4-Amino-3-chlorobenzoyl)-3-methyl-L-valyl-N-[(1S)-2-carboxy-1-formylethyl]-L-prolinamide; (S)-3-({1-((S)-1-((S)-2-{(1-(4-Amino-3-chlorophenyl)methanoyl)amino}-3,3-dimethyl-butanoyl)pyrrolidin-2-yl)methanoyl}amino)-4-oxobutyric acid. Grades: ≥98%. CAS No. 244133-31-1. Molecular formula: C22H29ClN4O6. Mole weight: 480.94.
VRX-806
VRX-806 is a novel nonnucleoside reverse transcriptase inhibitor (NNRTI) with potent in vitro activity against wild-type and NNRTI-resistant HIV-1. Synonyms: VRX-806; VRX 806; VRX806; AR-806; AR 806; AR806; RDEA-806; RDEA 806; RDEA806;4-[[2-[[5-bromo-4-(4-cyclopropylnaphthalen-1-yl)-1,2,4-triazol-3-yl]sulfanyl]acetyl]amino]-3-chlorobenzoic acid. Grades: >98 %. CAS No. 1004523-72-1. Molecular formula: C24H18BrClN4O3S. Mole weight: 557.85.
VS-5584
VS-5584 is a pan-PI3K/mTOR kinase inhibitor with IC50s of 16 nM, 68 nM, 42 nM, 25 nM, and 37 nM for PI3Kα, PI3Kβ, PI3Kδ, PI3Kγ and mTOR, respectively. VS-5584 simultaneously blocks mTORC2 as well as mTORC1. Synonyms: VS5584; VS 5584; VS5584; SB2343; SB2343; SB 2343. CAS No. 1246560-33-7. Molecular formula: C17H22N8O. Mole weight: 354.418.
VSe2 Crystal
VSe2 Crystal. Uses: Designed for use in research and industrial production. Product Category: Graphene-like Materials Series. CAS No. 12299-51-3. Purity: 0.99995. Product ID: ACM12299513. Alfa Chemistry ISO 9001:2015 Certified. Categories: Vanadium selenide (VSe2).
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide. Exendin-4 is a pure GLP-1 receptor agonist. Mole weight: 3241.7.
Vsp I
One unit of the enzyme is the amount required to hydrolyze 1 μg of Lambda DNA in 1 hour at 37°C in a total reaction volume of 50 μl. Applications: After 10-fold overdigestion with enzyme 70% of the dna fragments can be ligated.of these, 90% can be recut. in the presence of 10% peg ligation is better. Group: Restriction Enzymes. Purity: 1000U; 5000U. AT↑TAAT TAAT↓TA. Activity: 10000u.a./ml. Appearance: 10 X SE-buffer W. Storage: -20°C. Form: Liquid. Source: An E.coli strain, that carries the cloned gene VspI from Vibrio species 343. Pack: 10 mM Tris-HCl (pH 7.6); 50 mM NaCl; 0.1 mM EDTA; 1 mM DTT; 200 μg/ml BSA; 50% glycerol. Cat No: ET-1187RE.
VSPPLTLGQLLS
VSPPLTLGQLLS is a small peptide FGFR3 inhibitor, peptide P3, inhibits FGFR3 phosphorylation. VSPPLTLGQLLS inhibits 9-cisRA-induced tracheal lymphangiogenesis and blocks lymphatic endothelial cell (LEC) proliferation, migration, and tubule formation [1] [2]. Uses: Scientific research. Group: Peptides. CAS No. 1206896-24-3. Pack Sizes: 5 mg; 10 mg. Product ID: HY-P3695.
VSV-G Peptide
VSV-G Peptide, vesicular stomatitis virus G (VSV-G) protein fragment, is commonly engineered onto the N- or C- terminus of a protein of interest so that the tagged protein can be analyzed and visualized using immunochemical methods. Synonyms: H-Tyr-xiThr-Asp-xiIle-Glu-Met-Asn-Arg-Leu-Gly-Lys-OH; L-tyrosyl-(3xi)-L-threonyl-L-alpha-aspartyl-(3xi)-L-isoleucyl-L-alpha-glutamyl-L-methionyl-L-asparagyl-L-arginyl-L-leucyl-glycyl-L-lysine. Molecular formula: C57H94N16O19S. Mole weight: 1339.52.
VT-1161
VT-1161 is a 14-alpha demethylase inhibitor as a tetrazole antifungal agent originated by Viamet Pharmaceuticals. VT-1161 shows potent efficacy in treatment of dermatophytosis in a guinea pig model. Phase II clinical trials for the treatment of Onychomycosis and Vulvovaginal candidiasis is on-going. Uses: Onychomycosis; vulvovaginal candidiasis. Synonyms: VT 1161; VT1161; Oteseconazole. Grades: 98%. CAS No. 1340593-59-0. Molecular formula: C23H16F7N5O2. Mole weight: 527.40.
VT-1598
VT-1598 is an orally active and selective fungal inhibitor targeting CYP51. VT-1598 shows anti-fungal activity against Candida auris [1] [2]. VT-1598 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups. Uses: Scientific research. Group: Signaling pathways. CAS No. 2089320-99-8. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-123777.
VT-464
VT-464, also called as Seviteronel, is an oral, non-steroidal, lyase-selective CYP17 inhibitor to reach Phase II clinical trials in Breast cancer in USA (PO). in vitro: Approximately 10-fold more selective towards lyase than hydroxylase. Selective inhibit. Uses: Antineoplastic agents. Synonyms: (1S)-1-[6,7-bis(difluoromethoxy)naphthalen-2-yl]-2-methyl-1-(2H-triazol-4-yl)propan-1-ol; VT464; VT 464; VT-464; INO-464; INO 464; INO464;CHEMBL3264610; CS-3139; CS 3139; CS3139; HY-15996; UNII-8S5OIN36X4 component ZBRAJOQFSNYJMF-SFHVURJKSA-N; 1610537-15-9; 1H-1,2,3-Triazole-5-methanol, alpha-(6,7-bis(difluoromethoxy). CAS No. 1610537-15-9. Molecular formula: C18H17F4N3O3. Mole weight: 399.34.
VT-464 racemate
The racemate form of VT-464, a non-steroidal compound, has been found to lead to the reduction of androgen through acting as a human CYP17 lyase inhibitor. IC50: 69 nM. Uses: The racemate form of vt-464 has been found to lead to the reduction of androgen through acting as a human cyp17 lyase inhibitor. Synonyms: VT-464 racemate; VT 464 racemate; VT464 racemate; VT-464; CHEMBL3264610; CS-3139; CS 3139; CS3139; UNII-8S5OIN36X4 component ZBRAJOQFSNYJMF-SFHVURJKSA-N. Grades: 98%. CAS No. 1375603-36-3. Molecular formula: C18H17F4N3O3. Mole weight: 399.34.
VT-464 R enantiomer
The R-enantiomer form of VT-464, a non-steroidal compound, has been found to lead to the reduction of androgen through acting as a human CYP17 lyase inhibitor. Uses: The r-enantiomer form of vt-464 has been found to lead to the reduction of androgen through acting as a human cyp17 lyase inhibitor. Synonyms: VT-464 (R enantiomer); VT 464 R enantiomer; VT464 R enantiomer; CS-3140; CS 3140; CS3140; UNII-8S5OIN36X4 component ZBRAJOQFSNYJMF-GOSISDBHSA-N. Grades: 98%. CAS No. 1375603-38-5. Molecular formula: C18H17F4N3O3. Mole weight: 399.34.
VT-ME6
VT-ME6 is a selective sphingosine kinase 2 inhibitor. VT-ME6 shows three-fold selectivity for SphK2 over SphK1. It has a quaternary ammonium group which is necessary for engaging key amino acid residues in the enzyme binding pocket.13,14. Synonyms: VT-ME6, VT-ME-6, VT-ME 6; Dimethyl-[4-(4-octyl-phenyl)-cyclohexyl]-propyl-ammonium iodide. Grades: 98%. CAS No. 1353880-00-8. Molecular formula: C25H44IN. Mole weight: 484.54.
VTP-27999
VTP-27999 is an alkyl amine Renin inhibitor. It is useful for Hypertension and End-Organ Diseases. Synonyms: VTP-27999; VTP 27999; VTP27999. Grades: >98%. CAS No. 942142-51-0. Molecular formula: C26H41ClN4O5. Mole weight: 525.08.
VTP-27999 2,2,2-trifluoroacetate
VTP-27999 2,2,2-trifluoroacetate is an alkyl amine Renin inhibitor, useful for Hypertension and End-Organ Diseases. Synonyms: VTP-27999; VTP27999; VTP 27999. VTP-27999 HCl; VTP-27999 TFA. Grades: >98%. CAS No. 1013937-63-7. Molecular formula: C28H42ClF3N4O7. Mole weight: 639.1.
VTP-27999 Hydrochloride
VTP-27999 Hcl is an alkyl amine Renin inhibitor; VTP-27999 is useful for Hypertension and End-Organ Diseases. Uses: Scientific research. Group: Signaling pathways. CAS No. 1264191-73-2. Pack Sizes: 10 mM * 1 mL; 5 mg; 10 mg; 50 mg; 100 mg. Product ID: HY-76652.
VTP-27999 Hydrochloride
VTP-27999 Hcl is an alkyl amine Renin inhibitor; VTP-27999 is useful for Hypertension and End-Organ Diseases. Synonyms: VTP27999 Hydrochloride; VTP 27999 Hydrochloride. Grades: >98%. CAS No. 1264191-73-2. Molecular formula: C26H42Cl2N4O5. Mole weight: 561.54.
VTP-27999 TFA
VTP-27999 TFA is an alkyl amine Renin inhibitor; VTP-27999 TFA is useful for Hypertension and End-Organ Diseases. Uses: Scientific research. Group: Signaling pathways. CAS No. 1013937-63-7. Pack Sizes: 5 mg; 10 mg; 25 mg; 50 mg; 100 mg. Product ID: HY-50769.
VTP-37948
VTP-37948, also called BI 1181181, being clinically developed with Boehringer Ingelheim and Vitae Pharmaceuticals, is an inhibitor targeted to the catalytic site of the enzymes BACE1 and BACE2 designed for treating Alzheimer's disease. Synonyms: BI 1181181; BI-1181181; VTP-37948; BI1181181; VTP37948; VTP 37948.
VTP50469 is a Menin-MLL interaction inhibitor, effective against MLL rearrangement and NPM1c+ leukemia. It has effective anti-leukemia activity. Grades: ≥98% by HPLC. CAS No. 2169916-18-9. Molecular formula: C32H47FN6O4S. Mole weight: 630.82.
VTX-27
Selective PKC inhibitor. VTX-27 is a potent and selective inhibitor of the PKCth enzyme, with over 1000-fold against classical isoforms and over 10,000-fold against atypical isoforms. Group: Biochemicals. Grades: Highly Purified. CAS No. 1321924-70-2. Pack Sizes: 1mg, 5mg. Molecular Formula: C20H24ClFN6O, Form: Supplied as a. US Biological Life Sciences.
Worldwide
V type AAO Template(hole depth:260 nm)
V type AAO Template(hole depth:260 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-52. Alfa Chemistry ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE.
V type AAO Template(hole depth :500 nm)
V type AAO Template(hole depth :500 nm). Uses: Designed for use in research and industrial production. Product Category: Inorganic Nanomaterials. CAS No. 11092-32-3. Product ID: ACM11092323-33. Alfa Chemistry ISO 9001:2015 Certified. Categories: ALUMINUM OXIDE.